DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3588 and Vasp

DIOPT Version :9

Sequence 1:NP_570036.3 Gene:CG3588 / 31278 FlyBaseID:FBgn0025643 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_033525.2 Gene:Vasp / 22323 MGIID:109268 Length:375 Species:Mus musculus


Alignment Length:262 Identity:64/262 - (24%)
Similarity:85/262 - (32%) Gaps:105/262 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   670 QRWQPRTQNGTSSRGTSTNENFEYVYFNRTSSSSRL--EDLQPDNDDSSGRDLEVAGTPLNTSVD 732
            :||.|.   ||..:..|..:    :|.|.|::|.|:  ..:|||........: :.|...|.:..
Mouse    21 KRWLPA---GTGPQAFSRVQ----IYHNPTANSFRVVGRKMQPDQQVVINCAI-IRGVKYNQATP 77

  Fly   733 EFGPY-DSTQRQGRTFSVIYDWI---SGFFNSC----------------------VSPCTLEAFQ 771
            .|..: |:.|..|..|....|.|   :|..|:.                      .||..||..:
Mouse    78 IFHQWRDARQVWGLNFGSKEDAIQFATGMANALEALEGGGPPPAPAPPAWSAQNGPSPEELEQQK 142

  Fly   772 KQ-TCCETYVVDPSYPPPPP---PPPPPPPPQTCCAPVRPPYAPPVRPLPPP------------- 819
            :| ...|..|.:...||.||   |||||.||        ||..||    |||             
Mouse   143 RQPEHMERRVSNAGGPPAPPAGGPPPPPGPP--------PPPGPP----PPPGLPSSGVSGAGHG 195

  Fly   820 ----PPPPPPVPYPYTPIYPNKKTPVVVVATPINCCTVCTFTYYGPPPCGRLYNNSSSGSDGKKV 880
                |||.||:|                             |..||       |:..||:.|...
Mouse   196 AGAAPPPAPPLP-----------------------------TAQGP-------NSGGSGAPGLAA 224

  Fly   881 TI 882
            .|
Mouse   225 AI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3588NP_570036.3 None
VaspNP_033525.2 EVH1_Ena_VASP-like 5..113 CDD:269918 25/99 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..340 39/164 (24%)
EVH2 221..373 2/6 (33%)
EVH2 block A 221..241 2/6 (33%)
KLKR 230..233
EVH2 block B 257..274
VASP_tetra 337..371 CDD:285929
EVH2 block C 338..372
2 X 15 AA tandem repeats of L-[EQ]-[KR] [MV]-K-[EQ]-E-[IL]-[IL]-E-[AEV]-[FV]-[KRV]-[KQ]-E 339..368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11202
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.