DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and DI19

DIOPT Version :9

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001319253.1 Gene:DI19 / 842081 AraportID:AT1G56280 Length:206 Species:Arabidopsis thaliana


Alignment Length:39 Identity:13/39 - (33%)
Similarity:20/39 - (51%) Gaps:2/39 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DSFTCPVCGEMGFSVEDLRTHCQDNHRMARTVCICPVCA 137
            :.|.||.|.| .:.:..|..|..|.|.: .:..:||||:
plant    40 EEFACPFCAE-SYDIIGLCCHIDDEHTL-ESKNVCPVCS 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078
zf-Di19 99..149 CDD:283297 13/39 (33%)
DI19NP_001319253.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.