powered by:
Protein Alignment CG3526 and DI19
DIOPT Version :9
Sequence 1: | NP_726832.2 |
Gene: | CG3526 / 31277 |
FlyBaseID: | FBgn0040355 |
Length: | 229 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001319253.1 |
Gene: | DI19 / 842081 |
AraportID: | AT1G56280 |
Length: | 206 |
Species: | Arabidopsis thaliana |
Alignment Length: | 39 |
Identity: | 13/39 - (33%) |
Similarity: | 20/39 - (51%) |
Gaps: | 2/39 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 DSFTCPVCGEMGFSVEDLRTHCQDNHRMARTVCICPVCA 137
:.|.||.|.| .:.:..|..|..|.|.: .:..:||||:
plant 40 EEFACPFCAE-SYDIIGLCCHIDDEHTL-ESKNVCPVCS 76
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3526 | NP_726832.2 |
ZZ_PCMF_like |
30..78 |
CDD:239078 |
|
zf-Di19 |
99..149 |
CDD:283297 |
13/39 (33%) |
DI19 | NP_001319253.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.