DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and AT4G02200

DIOPT Version :9

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001154200.1 Gene:AT4G02200 / 827516 AraportID:AT4G02200 Length:228 Species:Arabidopsis thaliana


Alignment Length:173 Identity:35/173 - (20%)
Similarity:56/173 - (32%) Gaps:61/173 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 ADSFTCPVCGEMGFSVEDLRTHCQDNHRM--------------ARTVCICPVCA-AVPLSQPSHI 147
            |..:.||.|.: .:.:.:|..|..:.|::              .|...|||||: .|.:....||
plant    40 AVDYPCPFCSD-DYDLVELCHHIDEEHQLDANNGFLHEAVSCKFRLFIICPVCSRRVKMHMVDHI 103

  Fly   148 A-----------HIANHLMFSPSHRATGDPMIDISATSQAEGSSL-------------PQNSAV- 187
            .           ...::..|||..|.....:||...::.....|:             |:.|.: 
plant   104 TTQHRDVFKRLYKDESYSAFSPGTRKYLQSLIDEPLSTNHTSKSVLDPLLSFIYNPPSPKKSKLV 168

  Fly   188 --SSGSGAQHTFSSSENSQVRFLLPGNRAPLADSDDFNMDNWE 228
              .|.|.|    |..:||.:|              |....:||
plant   169 QPDSSSEA----SMEDNSLIR--------------DSTEKDWE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078
zf-Di19 99..149 CDD:283297 15/75 (20%)
AT4G02200NP_001154200.1 zf-Di19 42..108 CDD:283297 15/66 (23%)
Di19_C 130..221 CDD:291251 15/82 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.