Sequence 1: | NP_726832.2 | Gene: | CG3526 / 31277 | FlyBaseID: | FBgn0040355 | Length: | 229 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062689.2 | Gene: | Kcmf1 / 74287 | MGIID: | 1921537 | Length: | 381 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 69/199 - (34%) |
---|---|---|---|
Similarity: | 98/199 - (49%) | Gaps: | 32/199 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 SGHCNVRCDGCGNNRMTFYRYKCLHCLDYDLCSDCKENGVSNGLHSLDHPLQCLMDRDALELHFA 89
Fly 90 GEPIPILCADSFTCPVCGEMGFSVEDLRTHCQDNHRMARTVCICPVCAAVPLSQPSHI-----AH 149
Fly 150 I---------------ANHL--MFSPSHRATGDPMIDISATSQAEGSSLPQNSAVSSG-SGAQHT 196
Fly 197 FSSS 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3526 | NP_726832.2 | ZZ_PCMF_like | 30..78 | CDD:239078 | 23/47 (49%) |
zf-Di19 | 99..149 | CDD:283297 | 22/54 (41%) | ||
Kcmf1 | NP_062689.2 | ZZ_PCMF_like | 7..55 | CDD:239078 | 23/47 (49%) |
zf-Di19 | 76..137 | CDD:310299 | 24/60 (40%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 154..194 | 14/47 (30%) | |||
Di19_C | <280..328 | CDD:317030 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167850425 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1280 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0004459 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_107180 | |
Panther | 1 | 1.100 | - | - | O | PTHR12268 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.740 |