DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and Kcmf1

DIOPT Version :9

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001121664.1 Gene:Kcmf1 / 684322 RGDID:1591490 Length:381 Species:Rattus norvegicus


Alignment Length:199 Identity:69/199 - (34%)
Similarity:98/199 - (49%) Gaps:32/199 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SGHCNVRCDGCGNNRMTFYRYKCLHCLDYDLCSDCKENGVSNGLHSLDHPLQCLMDRDALELHFA 89
            |.|..|.||.|........|||||.|.|||||:.|.|:|.:...|:.|||:||::.|...:|::.
  Rat     2 SRHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYG 66

  Fly    90 GEPIPILCADSFTCPVCGEMGFSVEDLRTHCQDNHRMARTVCICPVCAAVPLSQPSHI-----AH 149
            ||...:....|||||.||:||::...|:.|....|....|..|||:|||:|...|:|:     ||
  Rat    67 GEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAH 131

  Fly   150 I---------------ANHL--MFSPSHRATGDPMIDISATSQAEGSSLPQNSAVSSG-SGAQHT 196
            :               ..|:  ||.|. |..|.|        :|..|::...|:.:.| |.:|.:
  Rat   132 LTLEHRAPRDLDESSGVRHVRRMFHPG-RGLGGP--------RARRSNMHFTSSSTGGLSSSQSS 187

  Fly   197 FSSS 200
            :|.|
  Rat   188 YSPS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078 23/47 (49%)
zf-Di19 99..149 CDD:283297 22/54 (41%)
Kcmf1NP_001121664.1 ZZ_PCMF_like 7..55 CDD:239078 23/47 (49%)
zf-Di19 76..137 CDD:398954 24/60 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354124
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004459
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107180
Panther 1 1.100 - - O PTHR12268
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.