DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and RNF125

DIOPT Version :9

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_060301.2 Gene:RNF125 / 54941 HGNCID:21150 Length:232 Species:Homo sapiens


Alignment Length:191 Identity:42/191 - (21%)
Similarity:62/191 - (32%) Gaps:55/191 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PRRRQIGHTSGHCNVRCDGCGNNRMTFYRYKCLHC-------------------LDYDLCSDCKE 61
            |.|.:.||      |.|..|....:...::.|.:|                   .:|..|::|  
Human    47 PVRTRCGH------VFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAEC-- 103

  Fly    62 NGVSNGLHSLDHPLQCLMDRDALELHFAG--------EPIPIL--CADSFTCPVCGEMGFSVEDL 116
                       ..|.||.:   :..|...        .|:..|  .|....||.| :.....:.|
Human   104 -----------DTLVCLSE---MRAHIRTCQKYIDKYGPLQELEETAARCVCPFC-QRELYEDSL 153

  Fly   117 RTHCQDNHRMARTVCICPVCAAVPLSQPSHIA-HIANHLMFSPSHRATGDPMIDISATSQA 176
            ..||..:||..|....||:|..:|...||..: .:..||..  ||....|..||.:...:|
Human   154 LDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQV--SHTLFYDDFIDFNIIEEA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078 9/66 (14%)
zf-Di19 99..149 CDD:283297 15/50 (30%)
RNF125NP_060301.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
RING-HC_RNF125 35..76 CDD:319456 8/34 (24%)
Interaction with the C2HC RNF-type zinc finger. /evidence=ECO:0000269|PubMed:27411375 43..45
zf_C2HC_14 94..126 CDD:408358 7/47 (15%)
Interaction with the RING-type zinc finger. /evidence=ECO:0000269|PubMed:27411375 109..113 1/6 (17%)
Linker region. /evidence=ECO:0000269|PubMed:27411375 120..128 0/7 (0%)
zf-Di19 141..>173 CDD:398954 11/32 (34%)
Required for interaction with ubiquitin and for autoubiquitination. /evidence=ECO:0000269|PubMed:17990982 210..224 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.