DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and Kcmf1

DIOPT Version :9

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001163560.1 Gene:Kcmf1 / 41082 FlyBaseID:FBgn0037655 Length:599 Species:Drosophila melanogaster


Alignment Length:217 Identity:77/217 - (35%)
Similarity:104/217 - (47%) Gaps:40/217 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SGHCNVRCDGCGNNRMTFYRYKCLHCLDYDLCSDCKENGVSNGLHSLDHPLQCLMDRDALELHFA 89
            |.|..|.||.|..:.....|||||.|.|||||:||.|:||::..|.::||:||::.|..:||:|.
  Fly     2 SRHEGVSCDSCLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHPMQCILTRSDIELYFG 66

  Fly    90 GEPIPILCAD---SFTCPVCGEMGFSVEDLRTHCQDNHRMARTVCICPVCAAVPLSQPSHIA-HI 150
            ||   :|.:|   |||||.|.:||||...|..|....|.......:|||||.:|..:|:.:. ..
  Fly    67 GE---MLASDQPQSFTCPYCKKMGFSDATLLEHVSAEHTETSLEVVCPVCAGLPGGEPNLVTDDF 128

  Fly   151 ANHLMFSPSHRATGDPMIDISATSQAEGSSLPQNSAVSSGSGAQHT----------------FSS 199
            |.||..  .||.....:|          |.|.:.||:..|.|.:..                |||
  Fly   129 AGHLTL--EHRQGPRELI----------SFLDEPSAIRHGGGVRRIPGRTLGGPRTRRSNMHFSS 181

  Fly   200 SENSQVRFLLPGNRA---PLAD 218
            |  |.:..|.|..|.   |:|:
  Fly   182 S--SGLSALSPSGRESVDPIAE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078 24/47 (51%)
zf-Di19 99..149 CDD:283297 21/53 (40%)
Kcmf1NP_001163560.1 ZZ_PCMF_like 7..55 CDD:239078 24/47 (51%)
zf-Di19 76..137 CDD:310299 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471876
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004459
OrthoInspector 1 1.000 - - otm14750
orthoMCL 1 0.900 - - OOG6_107180
Panther 1 1.100 - - P PTHR12268
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.