DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and Dyb

DIOPT Version :9

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001097287.1 Gene:Dyb / 36362 FlyBaseID:FBgn0033739 Length:816 Species:Drosophila melanogaster


Alignment Length:216 Identity:50/216 - (23%)
Similarity:77/216 - (35%) Gaps:64/216 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CDGCGNNRMTFYRYKCLHCLDYDLCSDCKENGVSNGLHSLDHPLQCLMDRDALELHFAGEPIPIL 96
            |..|.....|.:||:|..|..|.||.:|..:|.::..|..||.:     ::........:.|...
  Fly   234 CSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEV-----KEYSSYKSPSKQIGHS 293

  Fly    97 CADSFTC-PVCGEMGFSVEDLRTHCQDNHRMARTVCICPVCAAVPLSQPSHIAHIANHLMFS--P 158
            ...||.| |                      .:||.:.|   ..| .||....::::.:..|  |
  Fly   294 LRKSFRCVP----------------------EKTVQVLP---RFP-DQPEKTLNLSHIVPPSPLP 332

  Fly   159 SHRATGDP-------------------MIDISAT--SQAEGSSLPQNSAVSSGSGAQHTFSSSEN 202
            ||....||                   :.|.|:|  |:|.|.||...|. ::|:......::|.|
  Fly   333 SHNGFSDPSGLVHGHHGPHPGLPGQHGLFDRSSTLDSRATGRSLDSASG-TAGTTMSRVAAASAN 396

  Fly   203 SQ-----VRF---LLPGNRAP 215
            .:     .|:   |...||||
  Fly   397 DEEHRLIARYAARLAQENRAP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078 15/45 (33%)
zf-Di19 99..149 CDD:283297 10/50 (20%)
DybNP_001097287.1 EF-hand_2 7..131 CDD:286194
EF-hand_3 135..223 CDD:286195
ZZ_dystrophin 232..280 CDD:239074 15/50 (30%)
Ribosomal_L29 436..482 CDD:279204
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12268
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.