DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and CG15286

DIOPT Version :9

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001285929.1 Gene:CG15286 / 34834 FlyBaseID:FBgn0028531 Length:511 Species:Drosophila melanogaster


Alignment Length:187 Identity:51/187 - (27%)
Similarity:77/187 - (41%) Gaps:29/187 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HCNVRCDGCGNNRMTFYRYKCLHCLDYDLCSDCKENGVSNGLHSLDHPLQCLMDRDALELHFAGE 91
            |..:.|.|||...:||..|:||.|.|:|:|.:|.:|..:...|..|||:.|::....:||:|.||
  Fly     6 HERIECKGCGKRSLTFRCYRCLSCQDFDICEECYDNDFTTSTHPFDHPVVCVLIPADVELYFGGE 70

  Fly    92 PIPILCADSFTCPVCGEMGFSVEDLRTHCQDNHRMARTVCICPVCAAVPLSQPSHIAHIANHLMF 156
            .|......|:.||.|...||:......|....|..|..:.:..:.......|.:.: .:.|..:.
  Fly    71 YISNYPPQSYRCPYCKRWGFNESTFLEHVSAMHPDASPLLVSTMVGLFEQQQAARL-FLENEQLA 134

  Fly   157 SPSHRATGDPMIDISATSQAEGSSLPQNSAVSSGSGAQHTFSSSENSQVRFLLPGNR 213
            |          |.::|||:.|....|                  |.|...:|.|.||
  Fly   135 S----------IAVAATSRNELMRRP------------------EGSMALYLEPLNR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078 19/47 (40%)
zf-Di19 99..149 CDD:283297 10/49 (20%)
CG15286NP_001285929.1 ZZ_PCMF_like 9..57 CDD:239078 19/47 (40%)
zf-Di19 78..>107 CDD:283297 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471870
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004459
OrthoInspector 1 1.000 - - otm14750
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.