DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and CG31642

DIOPT Version :9

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_723159.1 Gene:CG31642 / 326149 FlyBaseID:FBgn0051642 Length:557 Species:Drosophila melanogaster


Alignment Length:161 Identity:44/161 - (27%)
Similarity:60/161 - (37%) Gaps:39/161 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HELSGSPSMPRRRQIGHTSGHCNVRCDGCGNNRMTFYRYKCLHCLDYDLCSDCKENGVSNGL--- 68
            |::...|    .|..||       ||:.|..:.....||.|..|.:|.||..|.:   :|.|   
  Fly     3 HQMRNPP----ERHFGH-------RCENCKISDFQGRRYTCRFCAEYTLCGKCFD---ANHLPAS 53

  Fly    69 --HSLDHPLQCLMDRDALELHFAGEPIPILCAD-----SFTCPVCGEMGFSVEDLRTHCQDNHR- 125
              |...||:.........:|:|.|||   .|.|     |:.|.:|...|.|...|..|....|| 
  Fly    54 PQHRYYHPMSVYYAYAEYQLYFGGEP---FCGDHKVAQSYKCALCDVRGLSTAHLFMHLLQEHRD 115

  Fly   126 ---------MARTVCICP--VCAAVPLSQPS 145
                     :..|:.|..  :...||:.|||
  Fly   116 HRDHDAYLSLVNTLYIADNGMEQQVPVPQPS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078 16/52 (31%)
zf-Di19 99..149 CDD:283297 17/64 (27%)
CG31642NP_723159.1 ZZ_PCMF_like 15..65 CDD:239078 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471867
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004459
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12268
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.