DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and dah

DIOPT Version :10

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_511162.1 Gene:dah / 32459 FlyBaseID:FBgn0015926 Length:649 Species:Drosophila melanogaster


Alignment Length:211 Identity:49/211 - (23%)
Similarity:69/211 - (32%) Gaps:68/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HCNVRCDGCGNNRMTFYRYKCLHCLDYDLCSDCKENGVSNGLHSLDH-----------PLQ---- 76
            |.| .|.||....:...|::|..|.|..||..|...|.:.|.|...|           ||:    
  Fly   279 HSN-SCAGCRKEHIVGIRFRCQVCRDISLCLPCFAVGFAGGRHEPGHRMCEVFVEDQPPLRWTRH 342

  Fly    77 ----C---LMDRDALELHFAG-----EPIPILCADSFTCPVCGEMGFSVEDLRTHCQDNHRMART 129
                |   :|.|...|....|     |..|.| ..|...|:..|    ...:|:.||:..   ||
  Fly   343 LARLCGWLVMPRKTQEEERRGFCNAQESGPAL-GQSAATPIPAE----TRSVRSQCQEKD---RT 399

  Fly   130 VCI----CPVCAAVPLSQ--PSHIAHIANHLMFSPSHRATGDPMIDISATSQAEGSSLPQNSAVS 188
            |.:    ..:|:...|:.  .|.:..|.:.|:.                          ||:.:.
  Fly   400 VVLQQQQQELCSLTGLASEASSRLQSIIDRLLL--------------------------QNAKLE 438

  Fly   189 SGSGAQHTFSSSENSQ 204
            :......|.||||.||
  Fly   439 TQLQTVATASSSEISQ 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078 17/69 (25%)
zf-Di19 99..149 CDD:428539 12/55 (22%)
dahNP_511162.1 EFh_DAH 81..250 CDD:320003
EF-hand-like motif 81..120 CDD:320003
EF-hand-like motif 132..166 CDD:320003
EF-hand-like motif 173..210 CDD:320003
EF-hand-like motif 223..250 CDD:320003
ZZ_dah 281..329 CDD:239085 15/48 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.