DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and dah

DIOPT Version :9

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_511162.1 Gene:dah / 32459 FlyBaseID:FBgn0015926 Length:649 Species:Drosophila melanogaster


Alignment Length:211 Identity:49/211 - (23%)
Similarity:69/211 - (32%) Gaps:68/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HCNVRCDGCGNNRMTFYRYKCLHCLDYDLCSDCKENGVSNGLHSLDH-----------PLQ---- 76
            |.| .|.||....:...|::|..|.|..||..|...|.:.|.|...|           ||:    
  Fly   279 HSN-SCAGCRKEHIVGIRFRCQVCRDISLCLPCFAVGFAGGRHEPGHRMCEVFVEDQPPLRWTRH 342

  Fly    77 ----C---LMDRDALELHFAG-----EPIPILCADSFTCPVCGEMGFSVEDLRTHCQDNHRMART 129
                |   :|.|...|....|     |..|.| ..|...|:..|    ...:|:.||:..   ||
  Fly   343 LARLCGWLVMPRKTQEEERRGFCNAQESGPAL-GQSAATPIPAE----TRSVRSQCQEKD---RT 399

  Fly   130 VCI----CPVCAAVPLSQ--PSHIAHIANHLMFSPSHRATGDPMIDISATSQAEGSSLPQNSAVS 188
            |.:    ..:|:...|:.  .|.:..|.:.|:.                          ||:.:.
  Fly   400 VVLQQQQQELCSLTGLASEASSRLQSIIDRLLL--------------------------QNAKLE 438

  Fly   189 SGSGAQHTFSSSENSQ 204
            :......|.||||.||
  Fly   439 TQLQTVATASSSEISQ 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078 17/69 (25%)
zf-Di19 99..149 CDD:283297 12/55 (22%)
dahNP_511162.1 EF-hand_2 44..168 CDD:286194
ZZ_dah 281..329 CDD:239085 15/48 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12268
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.