DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and RNF166

DIOPT Version :9

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_016878399.1 Gene:RNF166 / 115992 HGNCID:28856 Length:376 Species:Homo sapiens


Alignment Length:150 Identity:31/150 - (20%)
Similarity:48/150 - (32%) Gaps:54/150 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 HCQDNHRMARTVCICP----------VCAAVP-LSQPSHIAHIANHLMFSPSHR------ATGDP 166
            |.|..| :...|..||          :|...| ..||..:.|:..:.:..|..:      |...|
Human   222 HPQQVH-LRLPVLWCPQPGPAGAGEALCGKPPQRPQPRGVPHLLGNALGGPQLQERQLPAAPASP 285

  Fly   167 ----MIDISATSQAEGSSLPQ-NSAV-----------------SSGSGAQHTFSSSENSQVRFLL 209
                :..:..|..|.|.:.|: ||::                 |.|.|......||         
Human   286 TQVLLRHLCGTHLAPGPADPRTNSSLLVRPLPAPPCSFLALANSPGDGCHSLCQSS--------- 341

  Fly   210 PGNRAPLADS----DDFNMD 225
             |..||.|..    :|:::|
Human   342 -GTHAPPASGWKLLEDYSID 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078
zf-Di19 99..149 CDD:283297 10/40 (25%)
RNF166XP_016878399.1 PAT1 <196..>289 CDD:370676 14/67 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7943
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.