DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14416 and MED19

DIOPT Version :9

Sequence 1:NP_570031.1 Gene:CG14416 / 31273 FlyBaseID:FBgn0040352 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001287103.1 Gene:MED19 / 39987 FlyBaseID:FBgn0036761 Length:337 Species:Drosophila melanogaster


Alignment Length:223 Identity:50/223 - (22%)
Similarity:73/223 - (32%) Gaps:67/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PAPQDVGSGRDFMKKFML---------------MRGLFQQPPSDNVIVITQPSTTTTTTTPTGSP 91
            ||..::...:|.|.::.|               :....|..|..|.::                 
  Fly    59 PAKAELTGDKDLMTEYGLHHTLTKFKEKKFKESLASFLQNIPGINDLI----------------- 106

  Fly    92 TTTTSTTTTTTPTSNSTGRSLQESVHRQQPQDDDEAQETGVTTLTGRVLDDRLDLPDGEEEPQEL 156
                     |.|..|||.||:.|    :.|....|........|.|..|... .||:........
  Fly   107 ---------THPVENSTLRSVIE----KPPIGGKELLPLTPVQLAGFRLHPG-PLPEQYRTTYVT 157

  Fly   157 VTHKHTQKPKKFNMKSVKLNNRKKNLVK----KTHRRVHKHPQKKKRHQ------KRKLNKKQSA 211
            ...||..|.||...|......::..|:.    :|:.:.||   |:|||:      |||..||:..
  Fly   158 PARKHKNKHKKQKHKDGVTTGQESTLLDSAGLETYEKKHK---KQKRHEDDKERKKRKKEKKRKK 219

  Fly   212 ANQQRNSEPAVNFIEPYHQDRGQSQAGG 239
            .||  :.||.|..:.      |.:..||
  Fly   220 KNQ--SPEPGVGLLP------GGASLGG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14416NP_570031.1 None
MED19NP_001287103.1 Med19 50..202 CDD:287279 35/176 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.