DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14416 and Med19

DIOPT Version :9

Sequence 1:NP_570031.1 Gene:CG14416 / 31273 FlyBaseID:FBgn0040352 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001101211.1 Gene:Med19 / 311165 RGDID:1311926 Length:244 Species:Rattus norvegicus


Alignment Length:277 Identity:58/277 - (20%)
Similarity:79/277 - (28%) Gaps:108/277 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LQGRSASGSPAPQDVGSGRDFMKKFMLMRGLFQQPPSDNVIVITQPSTTTTTTTPTGSPTTTTST 97
            |.|......|.|..:|.|          .|....||               ...|.|.|.|...:
  Rat     7 LFGAQTDPPPPPSALGFG----------PGKPPPPP---------------PPPPGGGPGTAPPS 46

  Fly    98 TTTTTP--TSNSTGRSLQESVHRQQPQDDDEAQETGVTT----------LTGRVLDDRL------ 144
            |.|:.|  ...||..|....:.|:.|...:....|.:.|          ..|:.:.::|      
  Rat    47 TATSAPVGADKSTAGSGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPD 111

  Fly   145 -----DLPDGE---------EEP-------------------------QELVTHKHTQKPKKFNM 170
                 |||...         |:|                         .|.....|.|.|||   
  Rat   112 LPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPPKK--- 173

  Fly   171 KSVKLNNRKKNLVKKTHRRV---------HKHPQKKKRHQ-KRKLNKKQSAANQQRNSEPAVNFI 225
                 .|:.|:...:|...|         ||..:|||... :||..||:....:.|:|       
  Rat   174 -----KNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHS------- 226

  Fly   226 EPYHQDRGQSQAGGQST 242
             |.|...|.|||...|:
  Rat   227 -PDHPGMGSSQASSSSS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14416NP_570031.1 None
Med19NP_001101211.1 Med19 63..233 CDD:287279 34/185 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4043
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.