DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14416 and MED19

DIOPT Version :9

Sequence 1:NP_570031.1 Gene:CG14416 / 31273 FlyBaseID:FBgn0040352 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001304007.2 Gene:MED19 / 219541 HGNCID:29600 Length:244 Species:Homo sapiens


Alignment Length:269 Identity:56/269 - (20%)
Similarity:80/269 - (29%) Gaps:92/269 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LQGRSASGSPAPQDVGSGRDFMKKFMLMRGLFQQPPSDNVIVITQPSTTTTTTTPTGSPTTTTS- 96
            |.|..|...|.|..:|.|..            :.||.........|.|....|..|..|....| 
Human     7 LFGAQADPPPPPTALGFGPG------------KPPPPPPPPAGGGPGTAPPPTAATAPPGADKSG 59

  Fly    97 --------------TTTTTTPTSNSTGRSLQESVHRQQPQDDDEAQETGVTTLTGRVLDDRLDLP 147
                          :|..|..|:..|..:|:::.::...:...|.....:..|.|.:     |||
Human    60 AGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMI-----DLP 119

  Fly   148 DGE---------EEPQELVTH-------------------------KHTQKPKKFNMKSVKLNNR 178
            ...         |:|..|.:.                         .|.|.|||        .|:
Human   120 GSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKK--------KNK 176

  Fly   179 KKNLVKKTHRRV---------HKHPQKKKRHQ-KRKLNKKQSAANQQRNSEPAVNFIEPYHQDRG 233
            .|:...:|...|         ||..:|||... :||..||:....:.|:|        |.|...|
Human   177 HKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHS--------PDHPGMG 233

  Fly   234 QSQAGGQST 242
            .|||...|:
Human   234 SSQASSSSS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14416NP_570031.1 None
MED19NP_001304007.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 14/60 (23%)
Med19 63..233 CDD:287279 36/190 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..244 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4043
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.