Sequence 1: | NP_570031.1 | Gene: | CG14416 / 31273 | FlyBaseID: | FBgn0040352 | Length: | 258 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001304007.2 | Gene: | MED19 / 219541 | HGNCID: | 29600 | Length: | 244 | Species: | Homo sapiens |
Alignment Length: | 269 | Identity: | 56/269 - (20%) |
---|---|---|---|
Similarity: | 80/269 - (29%) | Gaps: | 92/269 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 LQGRSASGSPAPQDVGSGRDFMKKFMLMRGLFQQPPSDNVIVITQPSTTTTTTTPTGSPTTTTS- 96
Fly 97 --------------TTTTTTPTSNSTGRSLQESVHRQQPQDDDEAQETGVTTLTGRVLDDRLDLP 147
Fly 148 DGE---------EEPQELVTH-------------------------KHTQKPKKFNMKSVKLNNR 178
Fly 179 KKNLVKKTHRRV---------HKHPQKKKRHQ-KRKLNKKQSAANQQRNSEPAVNFIEPYHQDRG 233
Fly 234 QSQAGGQST 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14416 | NP_570031.1 | None | |||
MED19 | NP_001304007.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..56 | 14/60 (23%) | |
Med19 | 63..233 | CDD:287279 | 36/190 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 171..244 | 25/88 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4043 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |