DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12498 and RTF1

DIOPT Version :9

Sequence 1:NP_570030.1 Gene:CG12498 / 31272 FlyBaseID:FBgn0040356 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_011270.1 Gene:RTF1 / 852607 SGDID:S000003213 Length:558 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:40/175 - (22%)
Similarity:67/175 - (38%) Gaps:36/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DDENESW-----VNGYEKPPTPDLPVTSRDQLE------------------LLRLSRHRIGLLLV 72
            |||...:     .|.:::..|.|    .|:::|                  .||:.|..:.....
Yeast   199 DDEGSEYGDDEEYNPFDRRDTYD----KREEVEWAEEEDEQDREPEISDFNKLRIGRSFVAKFCF 259

  Fly    73 RPAFEQAVTGCFVRVNV-----SGQGELPDHRIAEVLGICELDFGYKVEQIPTNVALRLRYDDLE 132
            .|.||.||.||:.||||     :|:......||..|.    |...|.:.:..||....:......
Yeast   260 YPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVF----LQKPYNMGKFYTNQYFGVTQGKDR 320

  Fly   133 MQHEINDVSNLNFTQEEFELWRDNCVNQAISPPTTHILTRKKVEL 177
            ...::|..|:..|.::|::.:.....|..:..|:.|.|:.|..|:
Yeast   321 KVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNKTKEV 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12498NP_570030.1 Plus3 51..157 CDD:197843 28/128 (22%)
RTF1NP_011270.1 COG5296 1..558 CDD:227615 40/175 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I2730
eggNOG 1 0.900 - - E1_COG5296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003630
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.