DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12498 and Rtf1

DIOPT Version :9

Sequence 1:NP_570030.1 Gene:CG12498 / 31272 FlyBaseID:FBgn0040356 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_084388.2 Gene:Rtf1 / 76246 MGIID:1309480 Length:715 Species:Mus musculus


Alignment Length:197 Identity:54/197 - (27%)
Similarity:93/197 - (47%) Gaps:20/197 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QRSRHVRRPAAEIVRELRNLRASPLRIDDENE-------------------SWVNGYEKPPTPDL 49
            :|.:...| .||::.:.:.|:.|.:..|||.|                   ......|:.|....
Mouse   293 EREKRKNR-TAELLAKKQPLKTSEVYSDDEEEEDDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQ 356

  Fly    50 PVTSRDQLELLRLSRHRIGLLLVRPAFEQAVTGCFVRVNVSGQGELPDHRIAEVLGICELDFGYK 114
            ||:..::|..:|||||::......|.|.:.|||||||:.:......|.:|:||:.|:.|....|:
Mouse   357 PVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQ 421

  Fly   115 VEQIPTNVALRLRYDDLEMQHEINDVSNLNFTQEEFELWRDNCVNQAISPPTTHILTRKKVELYN 179
            :....||..|:||:.:.:....:..|||..||:.||..|::...:..:..||...:.:|::.:..
Mouse   422 LGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKE 486

  Fly   180 AL 181
            ||
Mouse   487 AL 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12498NP_570030.1 Plus3 51..157 CDD:197843 36/105 (34%)
Rtf1NP_084388.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..218
COG5296 194..628 CDD:227615 54/197 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..362 14/69 (20%)
Plus-3 364..462 CDD:281165 35/97 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 632..654
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 679..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003630
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.