DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12498 and rtf1

DIOPT Version :9

Sequence 1:NP_570030.1 Gene:CG12498 / 31272 FlyBaseID:FBgn0040356 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_012823707.1 Gene:rtf1 / 448631 XenbaseID:XB-GENE-993328 Length:677 Species:Xenopus tropicalis


Alignment Length:203 Identity:55/203 - (27%)
Similarity:95/203 - (46%) Gaps:22/203 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNQRSRHVRR--PAAEIVRELRNLRASPLRIDDENESWVN-GYEKP------------------ 44
            |...|:...:|  ..||::...:.|:.|.:..|||.|...: ..||.                  
 Frog   248 MEELRAEREKRKNKTAELIARKQPLKTSEVYSDDEEEEEDDKSSEKSNRSSRSSSSSDEDEETVE 312

  Fly    45 -PTPDLPVTSRDQLELLRLSRHRIGLLLVRPAFEQAVTGCFVRVNVSGQGELPDHRIAEVLGICE 108
             |...|||:..::|..:|||||::......|.|.:.|:|||||:.:......|.:|:||:.|:.|
 Frog   313 IPPKSLPVSLPEELNKVRLSRHKLERWCHMPFFAKTVSGCFVRIGIGNHNSKPVYRVAEITGVVE 377

  Fly   109 LDFGYKVEQIPTNVALRLRYDDLEMQHEINDVSNLNFTQEEFELWRDNCVNQAISPPTTHILTRK 173
            ....|::....||..|:||:.:.:....:..|||..||:.||..|::...:..:..||...:.:|
 Frog   378 TGKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKK 442

  Fly   174 KVELYNAL 181
            ::.:..|:
 Frog   443 ELSIKEAM 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12498NP_570030.1 Plus3 51..157 CDD:197843 35/105 (33%)
rtf1XP_012823707.1 COG5296 151..590 CDD:227615 55/203 (27%)
Plus-3 326..426 CDD:367344 34/99 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003630
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.