Sequence 1: | NP_570030.1 | Gene: | CG12498 / 31272 | FlyBaseID: | FBgn0040356 | Length: | 261 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012823707.1 | Gene: | rtf1 / 448631 | XenbaseID: | XB-GENE-993328 | Length: | 677 | Species: | Xenopus tropicalis |
Alignment Length: | 203 | Identity: | 55/203 - (27%) |
---|---|---|---|
Similarity: | 95/203 - (46%) | Gaps: | 22/203 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSNQRSRHVRR--PAAEIVRELRNLRASPLRIDDENESWVN-GYEKP------------------ 44
Fly 45 -PTPDLPVTSRDQLELLRLSRHRIGLLLVRPAFEQAVTGCFVRVNVSGQGELPDHRIAEVLGICE 108
Fly 109 LDFGYKVEQIPTNVALRLRYDDLEMQHEINDVSNLNFTQEEFELWRDNCVNQAISPPTTHILTRK 173
Fly 174 KVELYNAL 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12498 | NP_570030.1 | Plus3 | 51..157 | CDD:197843 | 35/105 (33%) |
rtf1 | XP_012823707.1 | COG5296 | 151..590 | CDD:227615 | 55/203 (27%) |
Plus-3 | 326..426 | CDD:367344 | 34/99 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0003630 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |