DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12498 and tplus3b

DIOPT Version :9

Sequence 1:NP_570030.1 Gene:CG12498 / 31272 FlyBaseID:FBgn0040356 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_724376.1 Gene:tplus3b / 318905 FlyBaseID:FBgn0051703 Length:439 Species:Drosophila melanogaster


Alignment Length:287 Identity:71/287 - (24%)
Similarity:119/287 - (41%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRELRNLRASPLRIDDENESWVNGYEKPPTPDLP----VTSRDQLELLRLSRHRIGLLLVRPAFE 77
            |:|..:..:||   :.|:|   |..:..|..::.    |::.:||....|.|:.|..||.:|.|.
  Fly    67 VKETYSGDSSP---NSESE---NTAQNDPQMNVESEERVSNLEQLSRAVLKRNDIKNLLGKPIFA 125

  Fly    78 QAVTGCFVRVNVSGQGELPDHRIAEVLGICELDFGYKVEQIPTNVALRLRYDDLEMQHEINDVSN 142
            :||.|.|||:||   |::  :.|.|.:.:.:....|:|:...||:.|.||....:....|:.|||
  Fly   126 EAVIGSFVRLNV---GKV--YSIYETIALHQDSKDYRVDGKRTNLILVLRCGSEKRYSRIDVVSN 185

  Fly   143 LNFTQEEFELWRDNCVNQAISPPTTHILTRKKVELYNALQL---------------EA------- 185
            ...||:||.||.:..:....:.||.:.:.:|:|::.||.:.               ||       
  Fly   186 QPITQKEFLLWLETNLRNRCTLPTLNDIAKKQVQVKNACKYSYTETDVEKLIQDKKEAGIKQNAA 250

  Fly   186 -KPLSL-IQRTFSFALRPQQKIGIMER---------------------------HGVVYPWQLNH 221
             :.:|| |:|..:..:...:|:.::|:                           .||..|....|
  Fly   251 YRKISLIIERDMAAGMNDVEKVQVLEKKILEIDEEPRPQIEKTGQHRYQVLSSTRGVHVPTIYRH 315

  Fly   222 SLPFVSQSPTENPSRGKADTVDEEEDP 248
            .|..        ||.||:..|.....|
  Fly   316 ELGV--------PSGGKSSFVKRTAKP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12498NP_570030.1 Plus3 51..157 CDD:197843 38/105 (36%)
tplus3bNP_724376.1 Plus-3 105..198 CDD:281165 36/97 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5296
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.