Sequence 1: | NP_570030.1 | Gene: | CG12498 / 31272 | FlyBaseID: | FBgn0040356 | Length: | 261 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055953.3 | Gene: | RTF1 / 23168 | HGNCID: | 28996 | Length: | 710 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 54/197 - (27%) |
---|---|---|---|
Similarity: | 93/197 - (47%) | Gaps: | 20/197 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 QRSRHVRRPAAEIVRELRNLRASPLRIDDENE-------------------SWVNGYEKPPTPDL 49
Fly 50 PVTSRDQLELLRLSRHRIGLLLVRPAFEQAVTGCFVRVNVSGQGELPDHRIAEVLGICELDFGYK 114
Fly 115 VEQIPTNVALRLRYDDLEMQHEINDVSNLNFTQEEFELWRDNCVNQAISPPTTHILTRKKVELYN 179
Fly 180 AL 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12498 | NP_570030.1 | Plus3 | 51..157 | CDD:197843 | 36/105 (34%) |
RTF1 | NP_055953.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 20..214 | ||
COG5296 | 189..623 | CDD:227615 | 54/197 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 228..357 | 14/69 (20%) | |||
Plus-3 | 359..459 | CDD:397304 | 35/99 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 627..650 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 674..710 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5296 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0003630 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |