DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12498 and rtfo-1

DIOPT Version :9

Sequence 1:NP_570030.1 Gene:CG12498 / 31272 FlyBaseID:FBgn0040356 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_505473.1 Gene:rtfo-1 / 179345 WormBaseID:WBGene00009103 Length:613 Species:Caenorhabditis elegans


Alignment Length:161 Identity:47/161 - (29%)
Similarity:79/161 - (49%) Gaps:18/161 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ASPLRIDDENESWVNGYEKPPTPDLPVTSRDQLELLRLSRHRIGLLLVRPAFEQAVTGCFVRVNV 89
            :||.|:.          ||.......|....:|...|||||::.|::..|.|:..|.||:||:  
 Worm   236 SSPERVS----------EKDKIVKKDVDGLSELRRARLSRHKLSLMIHAPFFDSTVVGCYVRL-- 288

  Fly    90 SGQGEL----PDHRIAEVLGICELDFGYKVEQIPTNVALRLRYDDLEMQHEINDVSNLNFTQEEF 150
             |||::    ..:||.:::|:.|.:..|::|...||..::.:....|....:..|||.:|.|.||
 Worm   289 -GQGQMSGSGSKYRIWKIVGVEESNKVYELEGKKTNKIIKCQNGGSERPFRMQFVSNADFEQIEF 352

  Fly   151 ELWRDNCVNQAISPPTTHILTRKKVELYNAL 181
            :.|...|.... :.||..|:.:||.::..|:
 Worm   353 DEWLLACKRHG-NLPTVDIMDKKKQDIEKAI 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12498NP_570030.1 Plus3 51..157 CDD:197843 35/109 (32%)
rtfo-1NP_505473.1 COG5296 82..503 CDD:227615 47/161 (29%)
Plus3 252..360 CDD:197843 35/110 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003630
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.