DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12498 and rtf1

DIOPT Version :9

Sequence 1:NP_570030.1 Gene:CG12498 / 31272 FlyBaseID:FBgn0040356 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001077046.1 Gene:rtf1 / 100000471 ZFINID:ZDB-GENE-030131-6778 Length:681 Species:Danio rerio


Alignment Length:225 Identity:57/225 - (25%)
Similarity:97/225 - (43%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNQRSRHVRRP-----------------------AAEIVRELRNLRASPLRIDDENE------- 35
            ||:.:.|.::|.                       .||::.:.:.|:.|.:..|||.|       
Zfish   225 MSHNKERRIKRDEKLDKKSQAMEELKAEREKRKNRTAELLAKRQPLKTSEVYSDDEEEEEDDDDK 289

  Fly    36 SWVNG--------------YEKPPTPDLPVTSRDQLELLRLSRHRIGLLLVRPAFEQAVTGCFVR 86
            |.|..              .|:.|....||:..|:|..:|||||::......|.|.:.|||||||
Zfish   290 SSVKSDRSSRSSSFDEEEEKEEAPPKSQPVSLPDELNRIRLSRHKLERWCHMPFFAKTVTGCFVR 354

  Fly    87 VNVSGQGELPDHRIAEVLGICELDFGYKVEQIPTNVALRLRYDDLEMQHEINDVSNLNFTQEEFE 151
            :.:......|.:|:||::.:.|....|::....||..|:||:.:......:..|||..||:.||.
Zfish   355 IGIGNSSNKPVYRVAEIIDVVETAKIYQLGSTRTNKGLQLRHGNDTRVFRLEFVSNQEFTESEFM 419

  Fly   152 LWRDNCVNQAISPPTTHILTRKKVELYNAL 181
            .|::..:...:..||...:.:|:..:..|:
Zfish   420 KWKEAMMIAGMQLPTLDEINKKEQSIKEAV 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12498NP_570030.1 Plus3 51..157 CDD:197843 36/105 (34%)
rtf1NP_001077046.1 COG5296 152..589 CDD:227615 57/225 (25%)
Plus-3 325..423 CDD:281165 34/97 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003630
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.