DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment w and ABCG5

DIOPT Version :9

Sequence 1:NP_476787.1 Gene:w / 31271 FlyBaseID:FBgn0003996 Length:687 Species:Drosophila melanogaster
Sequence 2:NP_071881.1 Gene:ABCG5 / 64240 HGNCID:13886 Length:651 Species:Homo sapiens


Alignment Length:630 Identity:181/630 - (28%)
Similarity:313/630 - (49%) Gaps:103/630 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 KHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRL----LNGQPVDAKE 170
            :.:||:|......|:::.::||||:||||||:|::.|      :..:|..|    :||:.:..::
Human    66 RQILKDVSLYVESGQIMCILGSSGSGKTTLLDAMSGR------LGRAGTFLGEVYVNGRALRREQ 124

  Fly   171 MQARCAYVQQDDLFIGSLTAREHLIFQAM--VRMPRHLTYRQRVARVDQVIQELSLSKCQHTIIG 233
            .|...:||.|.|..:.|||.||.|.:.|:  :|.....::::   :|:.|:.|||||.....:||
Human   125 FQDCFSYVLQSDTLLSSLTVRETLHYTALLAIRRGNPGSFQK---KVEAVMAELSLSHVADRLIG 186

  Fly   234 VPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQVLKKLSQKGKTVILTIH 298
             ...:.|:|.|||:|::.|::.|.||.:::.||||:|||..||:.:|.:|.:|:::.:.|:||||
Human   187 -NYSLGGISTGERRRVSIAAQLLQDPKVMLFDEPTTGLDCMTANQIVVLLVELARRNRIVVLTIH 250

  Fly   299 QPSSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCPTNYNPADFYVQVLAV---VPGRE 360
            ||.||||:|||||.:::.|.:.|.|||:|.:|||:..|..||.:.||.|||:.:.:|   ...||
Human   251 QPRSELFQLFDKIAILSFGELIFCGTPAEMLDFFNDCGYPCPEHSNPFDFYMDLTSVDTQSKERE 315

  Fly   361 IESRDRIAKICDNFAIS----KVARDMEQLLATKNLE----KPLEQPENGYTYKATWFMQFRAVL 417
            ||:..|:..|...:..|    |..:::|::...|.|.    |..:.|  |.      |.:...:|
Human   316 IETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVPFKTKDSP--GV------FSKLGVLL 372

  Fly   418 WRSWLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQV---GVMNINGAIFLFLTNMTFQNVF 479
            .|...::::..|.|..||:|..::.:.: |.|:.:..:.|   .:.:..|.::.|:....:..:.
Human   373 RRVTRNLVRNKLAVITRLLQNLIMGLFL-LFFVLRVRSNVLKGAIQDRVGLLYQFVGATPYTGML 436

  Fly   480 ATINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPLFLTVPLVFTAIAYPMIGLRAGVLHF-- 542
            ..:|:|.....|..:|::..||:.....|...:..||..:...::|:::.|..:||...|..|  
Human   437 NAVNLFPVLRAVSDQESQDGLYQKWQMMLAYALHVLPFSVVATMIFSSVCYWTLGLHPEVARFGY 501

  Fly   543 -------------FNCLALVTLV--ANVSTSFGYLISCASSSTSMALSVGPPVIIPFLLFGGFFL 592
                         |..|.|:.:|  .|:..|...|:|.|.                .|:..||..
Human   502 FSAALLAPHLIGEFLTLVLLGIVQNPNIVNSVVALLSIAG----------------VLVGSGFLR 550

  Fly   593 NSGSVPVYLKWLSYLSWFRYANEGLLINQWADVEPGEISCTSSNT-------------------T 638
            |...:|:..|.:||.::.:|.:|.|::|::..:   ..:|.|||.                   |
Human   551 NIQEMPIPFKIISYFTFQKYCSEILVVNEFYGL---NFTCGSSNVSVTTNPMCAFTQGIQFIEKT 612

  Fly   639 CPSSGKVILETLNFSA--ADLPLDYVGLAIL-IVSFRVLAYLALR 680
            ||  |.....|:||..  :.:|    .|.|| ||.|::..:|..|
Human   613 CP--GATSRFTMNFLILYSFIP----ALVILGIVVFKIRDHLISR 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wNP_476787.1 3a01204 68..687 CDD:273361 181/630 (29%)
ABCG5NP_071881.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
ABCG_White 50..275 CDD:213201 82/218 (38%)
3a01204 60..645 CDD:273361 179/622 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1022017at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR48041
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.