DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment w and Abca1

DIOPT Version :9

Sequence 1:NP_476787.1 Gene:w / 31271 FlyBaseID:FBgn0003996 Length:687 Species:Drosophila melanogaster
Sequence 2:XP_038965774.1 Gene:Abca1 / 313210 RGDID:631344 Length:2263 Species:Rattus norvegicus


Alignment Length:224 Identity:65/224 - (29%)
Similarity:104/224 - (46%) Gaps:29/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNGQPV--DAKEM 171
            ||..:..:|....|||...::|.:|||||:     .|:...|......|..|||...:  :..|:
  Rat  1927 RKPAVDRICVGIPPGECFGLLGVNGAGKTS-----TFKMLTGDTAVTRGDALLNKNSILSNIHEV 1986

  Fly   172 QARCAYVQQDDLFIGSLTAREHLIFQAMVR-MPRHLTYRQRVARVDQ-VIQELSLSKCQHTIIGV 234
            .....|..|.|.....||.||||.|.|::| :|     .:.|.:|.: .|::|.|.|.....   
  Rat  1987 HQNMGYCPQFDAITELLTGREHLEFFALLRGVP-----EKEVGKVGEWAIRKLGLVKYGEKY--- 2043

  Fly   235 PGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLD----SFTAHSVVQVLKKLSQKGKTVIL 295
               ....|||.:::|:.|...:..||::..||||:|:|    .|..:..:.::|    :|::|:|
  Rat  2044 ---ASNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIIK----EGRSVVL 2101

  Fly   296 TIHQPSSELFELFDKILLMAEGRVAFLGT 324
            |.|. ..|...|..::.:|..||...||:
  Rat  2102 TSHS-MEECEALCTRMAIMVNGRFRCLGS 2129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wNP_476787.1 3a01204 68..687 CDD:273361 65/224 (29%)
Abca1XP_038965774.1 rim_protein 1..2238 CDD:130324 65/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.