DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment w and Abca4

DIOPT Version :9

Sequence 1:NP_476787.1 Gene:w / 31271 FlyBaseID:FBgn0003996 Length:687 Species:Drosophila melanogaster
Sequence 2:NP_001101191.1 Gene:Abca4 / 310836 RGDID:1309445 Length:2290 Species:Rattus norvegicus


Alignment Length:422 Identity:95/422 - (22%)
Similarity:170/422 - (40%) Gaps:128/422 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LRPPSPPEDS-------GSGSGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERHI 105
            :..|..||||       |...|...:||.          .|.:|||  |..|:|....|      
  Rat   885 IEDPEYPEDSFFERELPGLVPGVCVKNLV----------KVFEPGS--RPAVDRLNITF------ 931

  Fly   106 PAPRKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNGQPVD--- 167
                           |..::.|.:|.:||||||.|:.|.     |:....||..|:.|:.::   
  Rat   932 ---------------YENQITAFLGHNGAGKTTTLSILT-----GLLPPTSGTVLIGGKDIEISL 976

  Fly   168 --AKEMQARCAYVQQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQELSLSKCQHT 230
              .::....|   .|.::....||..||::|.|.:   :..::.:....::.::::..|...::.
  Rat   977 DAVRQSLGMC---PQHNILFHHLTVAEHILFYAQL---KGRSWEEARLEMEAMLEDTGLHHKRNE 1035

  Fly   231 IIGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQVLKKLSQKGKTVIL 295
                  ..:.||||.:::|:.|...:.|..:::.||||||:|.::..|:..:|.|. :.|:|:|:
  Rat  1036 ------EAQDLSGGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLLLKY-RSGRTIIM 1093

  Fly   296 -TIHQPSSELFELFDKILLMAEGRVAFLGTPSEAVDFFS---YV--------------------- 335
             |.|...::|  |.|:|.::::||:...|||....:.|.   |:                     
  Rat  1094 STHHMDEADL--LGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRCGCEGACS 1156

  Fly   336 ------GAQCPTNYNPADFYVQVLAVVPGREIESRDRI------AKICD-------------NF- 374
                  .|:||...:.    :....|:.|...|..|.:      ||:.:             || 
  Rat  1157 CTSKGFSARCPARVDE----ITEEQVLDGDVKELTDLVYHHVPEAKLVECIGQELIFLLPNKNFK 1217

  Fly   375 --AISKVARDMEQLLATKNL------EKPLEQ 398
              |.:.:.|::|:.||...|      :.|||:
  Rat  1218 QRAYASLFRELEETLADLGLSSFGISDTPLEE 1249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wNP_476787.1 3a01204 68..687 CDD:273361 87/395 (22%)
Abca4NP_001101191.1 rim_protein 1..2249 CDD:130324 95/422 (23%)
ABC_subfamily_A 907..1126 CDD:213230 66/271 (24%)
ABC_subfamily_A 1915..2135 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.