DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment w and Abca7

DIOPT Version :9

Sequence 1:NP_476787.1 Gene:w / 31271 FlyBaseID:FBgn0003996 Length:687 Species:Drosophila melanogaster
Sequence 2:NP_997481.1 Gene:Abca7 / 299609 RGDID:1303134 Length:2170 Species:Rattus norvegicus


Alignment Length:224 Identity:69/224 - (30%)
Similarity:105/224 - (46%) Gaps:29/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNGQPVDAKEMQA 173
            |...:.::|....|||...::|.:|||||:     .||...|..:..||..:|.|..| |:|..|
  Rat  1831 RSPAVDHLCLGIPPGECFGLLGVNGAGKTS-----TFRMVTGDTLPSSGEAVLAGHNV-AQEPSA 1889

  Fly   174 ---RCAYVQQDDLFIGSLTAREHL-IFQAMVRMPRHLTYRQRVARVDQVIQELSLSKCQHTIIGV 234
               ...|..|.|.....||.|||| :|..:..:|.        |:|.|.    :||....  :|:
  Rat  1890 AHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPE--------AQVAQT----ALSGLVR--LGL 1940

  Fly   235 PG---RVKG-LSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQVLKKLSQKGKTVIL 295
            |.   |..| .|||.:::||.|...:.||.::..||||:|:|......:...|..:.::|::|:|
  Rat  1941 PSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNNLLSVVREGRSVVL 2005

  Fly   296 TIHQPSSELFELFDKILLMAEGRVAFLGT 324
            |.|. ..|...|..::.:|..||...||:
  Rat  2006 TSHS-MEECEALCTRLAIMVNGRFRCLGS 2033

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wNP_476787.1 3a01204 68..687 CDD:273361 69/224 (31%)
Abca7NP_997481.1 rim_protein 1..2127 CDD:130324 69/224 (31%)
ABC2_membrane <557..742 CDD:304374
ABC_subfamily_A 805..1024 CDD:213230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1044..1086
ABC_subfamily_A 1818..2038 CDD:213230 69/224 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2129..2170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.