DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment w and Abca2

DIOPT Version :9

Sequence 1:NP_476787.1 Gene:w / 31271 FlyBaseID:FBgn0003996 Length:687 Species:Drosophila melanogaster
Sequence 2:XP_006497672.1 Gene:Abca2 / 11305 MGIID:99606 Length:2464 Species:Mus musculus


Alignment Length:288 Identity:72/288 - (25%)
Similarity:128/288 - (44%) Gaps:26/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 VCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNGQPV--DAKEMQARCAYV 178
            :|....|||...::|.:|||||:     .|:...|.:.:..|...:||..|  |..::|....|.
Mouse  2104 LCLGVRPGECFGLLGVNGAGKTS-----TFKMLTGDESTTGGEAFVNGHSVLKDLLQVQQSLGYC 2163

  Fly   179 QQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQELSLSKCQHTIIGVPGRVKGLSG 243
            .|.|.....|||||||  |...|: |.:.::.....|...:::|.|:|......|.      .||
Mouse  2164 PQFDALFDELTAREHL--QLYTRL-RGIPWKDEAQVVKWALEKLELTKYADKPAGT------YSG 2219

  Fly   244 GERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQVLKKLSQKGKTVILTIHQPSSELFELF 308
            |.:::|:.|...:..|..:..||||:|:|......:..::..|.:.|::|:||.|. ..|...|.
Mouse  2220 GNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGRSVVLTSHS-MEECEALC 2283

  Fly   309 DKILLMAEGRVAFLGTPSEAVDFFS---YVGAQCPTNYNPADFYVQVLAVVPGREIESRDRIAKI 370
            .::.:|..||:..||:.....:.|.   .:..:..::.|..|.........|...::.|.. .|:
Mouse  2284 TRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVRTKSSQNVKDVVRFFNRNFPEAMLKERHH-TKV 2347

  Fly   371 -----CDNFAISKVARDMEQLLATKNLE 393
                 .::.::::|...|||::....:|
Mouse  2348 QYQLKSEHISLAQVFSKMEQVVGVLGIE 2375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wNP_476787.1 3a01204 68..687 CDD:273361 72/288 (25%)
Abca2XP_006497672.1 rim_protein 58..2398 CDD:130324 72/288 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.