DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32795 and ints14

DIOPT Version :9

Sequence 1:NP_001245509.1 Gene:CG32795 / 31270 FlyBaseID:FBgn0040384 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001007939.1 Gene:ints14 / 493315 XenbaseID:XB-GENE-978854 Length:518 Species:Xenopus tropicalis


Alignment Length:305 Identity:62/305 - (20%)
Similarity:111/305 - (36%) Gaps:83/305 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IILGDVNVSILNRNDKVRYKDDYEKFKLILNVIGLIMAFFNLIFNYRALELA--FIFLLVWY--- 164
            :::.||::| :.|...|...:::::..|.::  ||.|.|.::..||: ||..  .:|..:|.   
 Frog     4 VVVMDVSLS-MTRPVPVEGTEEFQRKHLAVH--GLTMLFEHMATNYK-LEFTAMVVFSSLWELMV 64

  Fly   165 -----YCTL------------TIRESILKVNGSRIKGWWRAHHFISTVAAGVLLVWP-------- 204
                 |.||            |..||.|:...|.::..|.|     ::.:.::||..        
 Frog    65 PFTRDYNTLQEALSNIDDYDKTCLESALQGVSSVVQQEWGA-----SIPSQIVLVTDGCLGIGKG 124

  Fly   205 ----------QGEHWQIFRMQFMY-FNVYI---SIVQYLQFGYQKGLLYRLKALGERHNMDITIE 255
                      |......|.:.|.: ..:||   :.::.||.......|.||..|........||:
 Frog   125 SLQHSLATLNQRNDSNRFPLPFSFPSKLYIMCMANLEELQGSDSLEYLERLIDLNNGEGQIFTID 189

  Fly   256 GFHSWMWRGLSFLLPFLFIGYGYQAYNAWTLYKLAYSPPDAPWHVSVMSGLFLLLFVGNMATTLW 320
            |         ...|..:...:|       .|..:||:    |:|.        :|..||:::.:.
 Frog   190 G---------PLCLKNVQSMFG-------KLIDVAYT----PFHA--------VLKCGNLSSDVQ 226

  Fly   321 VVPEKIRERAKERYRLQSMGKSMKLRKEMKNSASDLDLSSGSKLS 365
            |.|..  |.......:..:.|::....|:.......|:||...||
 Frog   227 VFPRP--EPVITDEEIDPLPKTINTDLEVVGFIDIADISSPPVLS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32795NP_001245509.1 TMPIT 7..329 CDD:285135 54/267 (20%)
ints14NP_001007939.1 VWA_2 3..117 CDD:379234 28/121 (23%)
NK <357..489 CDD:388413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165177586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.