DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32795 and SPAC3G9.05

DIOPT Version :9

Sequence 1:NP_001245509.1 Gene:CG32795 / 31270 FlyBaseID:FBgn0040384 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_594077.1 Gene:SPAC3G9.05 / 2543517 PomBaseID:SPAC3G9.05 Length:659 Species:Schizosaccharomyces pombe


Alignment Length:119 Identity:24/119 - (20%)
Similarity:53/119 - (44%) Gaps:7/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IDSLKNEWEELN-KEFAELESCNRRYIELLEQLH--SHQ-QICFNEIKHQRYRMNQITTSLRQFK 63
            :||.|:|.|.|. |..::.........:|.|:||  ||: :|...::.....|:.::..:.....
pombe   244 LDSSKSEMEALKAKSISDATKHKNEIFQLEEKLHEASHEAEISIKKLNDAENRIKELENNPTLSF 308

  Fly    64 GPVPAEDKEKVDDLHKMTLKRKAQLHEIE---QSLPAKSGRYLQIILGDVNVSI 114
            .|...::.:.:.:|......:...:.|:|   .||.|::.|:.::.:...:..|
pombe   309 NPELEKNLKLMQELIVAESSKTQHIVELESCIDSLKAETERWKKVAINAKSAKI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32795NP_001245509.1 TMPIT 7..329 CDD:285135 22/115 (19%)
SPAC3G9.05NP_594077.1 GIT_SHD 34..61 CDD:285690
GIT 82..112 CDD:128828
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.