DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32795 and tmem120aa

DIOPT Version :9

Sequence 1:NP_001245509.1 Gene:CG32795 / 31270 FlyBaseID:FBgn0040384 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001076452.1 Gene:tmem120aa / 100005623 ZFINID:ZDB-GENE-070424-21 Length:341 Species:Danio rerio


Alignment Length:326 Identity:158/326 - (48%)
Similarity:223/326 - (68%) Gaps:1/326 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EWEELNKEFAELESCNRRYIELLEQLHSHQQICFNEIKHQRYRMNQITTSLRQFKGPVPAEDKEK 73
            |||:|.|::.:::..:|.|...||::...|:.|.:.|..||.::..::.||.:.||.|..||..|
Zfish    14 EWEDLEKDYQQIQDTHRHYKHKLEEVSKLQESCSSSIARQRKKLKDLSESLEECKGAVNPEDVNK 78

  Fly    74 VDDLHKMTLKRKAQLHEIEQSLPAKSGRYLQIILGDVNVSILNRNDKVRYKDDYEKFKLILNVIG 138
            :||:.:...:|.....|:|..||.|:|.||.::||:|||::||:..|..|||:||||||.|.|:.
Zfish    79 IDDIQESIKERPNVFFEMEAFLPKKNGLYLSLVLGNVNVTLLNKQSKFAYKDEYEKFKLYLTVLL 143

  Fly   139 LIMAF-FNLIFNYRALELAFIFLLVWYYCTLTIRESILKVNGSRIKGWWRAHHFISTVAAGVLLV 202
            |..:| ...:.:||.::..|.|||||||||||||||||..|||:|||||...|::||..:||:|.
Zfish   144 LFFSFTCRFLVSYRVVDALFNFLLVWYYCTLTIRESILINNGSKIKGWWVFQHYVSTFLSGVMLT 208

  Fly   203 WPQGEHWQIFRMQFMYFNVYISIVQYLQFGYQKGLLYRLKALGERHNMDITIEGFHSWMWRGLSF 267
            ||.||.:|:||.||:.:::||:.||:.|:.||.|.||||:|||||||||:|:|||.|||||||:|
Zfish   209 WPDGELYQMFRNQFLSYSMYINFVQFFQYYYQSGCLYRLRALGERHNMDLTVEGFQSWMWRGLTF 273

  Fly   268 LLPFLFIGYGYQAYNAWTLYKLAYSPPDAPWHVSVMSGLFLLLFVGNMATTLWVVPEKIRERAKE 332
            ||||||:|:.:|.||..||:::...|....|.|.:....||:||:||..|||.||..|..::.|.
Zfish   274 LLPFLFLGHFFQLYNGITLFQMTQLPEWKEWQVLMCGSTFLVLFMGNFFTTLGVVYHKYMDQDKA 338

  Fly   333 R 333
            :
Zfish   339 K 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32795NP_001245509.1 TMPIT 7..329 CDD:285135 157/320 (49%)
tmem120aaNP_001076452.1 TMPIT 12..335 CDD:285135 157/320 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595935
Domainoid 1 1.000 334 1.000 Domainoid score I1105
eggNOG 1 0.900 - - E1_KOG4758
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12907
Inparanoid 1 1.050 336 1.000 Inparanoid score I2369
OMA 1 1.010 - - QHG55657
OrthoDB 1 1.010 - - D398151at33208
OrthoFinder 1 1.000 - - FOG0002380
OrthoInspector 1 1.000 - - otm25225
orthoMCL 1 0.900 - - OOG6_103806
Panther 1 1.100 - - LDO PTHR21433
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3603
SonicParanoid 1 1.000 - - X1574
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.