DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and STX11

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_011534515.1 Gene:STX11 / 8676 HGNCID:11429 Length:313 Species:Homo sapiens


Alignment Length:276 Identity:63/276 - (22%)
Similarity:119/276 - (43%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFNENEMDELHNKNLRL 135
            |.|.....|:....|:..:|:.:|..:...|   ||::.|..:.:.    :||::.....|  ||
Human    36 DLSKQYDQQFPDGDDEFDSPHEDIVFETDHI---LESLYRDIRDIQ----DENQLLVADVK--RL 91

  Fly   136 GNQ------LMTRFNDFKAN-------LPAEND----------------------YSLEARMKRT 165
            |.|      .|.|.:..|.:       :.|..:                      :|..||:.|.
Human    92 GKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMKELSEAAEAQHGPHSAVARISRA 156

  Fly   166 LFYGLHQTFINLWHK-NELFLQ---NYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVD 226
            .:..|..||....|. |:..::   |.:.::::.|    :|:..|.|..:||.:.|.....:|.:
Human   157 QYNALTLTFQRAMHDYNQAEMKQRDNCKIRIQRQL----EIMGKEVSGDQIEDMFEQGKWDVFSE 217

  Fly   227 NFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHV 291
            |.|.:.:..|..|.|:..|..||.|||..|.:||.||:::..||.:|::.:..:|.:.|:...:.
Human   218 NLLADVKGARAALNEIESRHRELLRLESRIRDVHELFLQMAVLVEKQADTLNVIELNVQKTVDYT 282

  Fly   292 DKGADELDQAEQHQKK 307
            .:...::.:|.|:::|
Human   283 GQAKAQVRKAVQYEEK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 52/218 (24%)
SNARE_syntaxin1-like 238..298 CDD:277201 18/59 (31%)
STX11XP_011534515.1 Syntaxin 67..264 CDD:279182 50/206 (24%)
SynN 67..219 CDD:238105 32/161 (20%)
SNARE_syntaxin11 229..291 CDD:277231 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.