DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and STX16

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001001433.1 Gene:STX16 / 8675 HGNCID:11431 Length:325 Species:Homo sapiens


Alignment Length:256 Identity:53/256 - (20%)
Similarity:127/256 - (49%) Gaps:23/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VDDILNPYTEIRQQLAQIAA------NLETMNRMAQTVNLRTFNENEMDELHNKNLRLGNQLMTR 142
            ||:|......|:|::.::|:      |..|::..::..:.......|:.:|.::..|....|.:|
Human    82 VDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSR 146

  Fly   143 FNDFKANLPAENDYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSEA 207
                 |...:|.:..|...:..:|...|.:...:..|....:|:..:.:.:::....        
Human   147 -----ARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFF-------- 198

  Fly   208 SEQEIELLIENKTTKLFVDNFLQE--TEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLV 270
             :..:.|:.:.....|:...|.::  ...|:.||. :.:|..|:|::.:||.:::.:|..:..::
Human   199 -DTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTLM-VEEREREIRQIVQSISDLNEIFRDLGAMI 261

  Fly   271 MEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIMLIVILAAVLLVLLLVGI 331
            :||..|:.|::::.:|:.:..:.|..:|.:|||:|||.||..::||:.:..::|:::|||:
Human   262 VEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 29/187 (16%)
SNARE_syntaxin1-like 238..298 CDD:277201 14/59 (24%)
STX16NP_001001433.1 COG5325 75..301 CDD:227635 45/233 (19%)
SNARE_syntaxin16 233..291 CDD:277198 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.