DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and SSO1

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_015092.1 Gene:SSO1 / 855844 SGDID:S000006153 Length:290 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:77/309 - (24%)
Similarity:137/309 - (44%) Gaps:58/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NNSYSVVSQNSHSCSNNNSSTEPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRM 111
            ||.|.:.:....|..        .|..||.:...|.:....:|..::|.:.|          ::.
Yeast     4 NNPYQLETPFEESYE--------LDEGSSAIGAEGHDFVGFMNKISQINRDL----------DKY 50

  Fly   112 AQTVNLRTFNENEMDELHNKNLRLGNQLMTRFNDFKA--------NLPAEN---DYSLEARMKRT 165
            ..|:       |::|.||.:       |:|..|:.:|        |..|:.   .:.|:..:|..
Yeast    51 DHTI-------NQVDSLHKR-------LLTEVNEEQASHLRHSLDNFVAQATDLQFKLKNEIKSA 101

  Fly   166 LFYGLHQT------------FINLWHKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIEN 218
            ...|:|.|            |:.|.....:...||:.:.|:..:....||..||:|.|:|..|.:
Yeast   102 QRDGIHDTNKQAQAENSRQRFLKLIQDYRIVDSNYKEENKEQAKRQYMIIQPEATEDEVEAAISD 166

  Fly   219 -KTTKLFVDNFLQETEK-ERQT-LREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRV 280
             ...::|....|....: |.:| |.|:..|..||.:||||:.|:..||..::.||:||.|.:..:
Yeast   167 VGGQQIFSQALLNANRRGEAKTALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVI 231

  Fly   281 EFHAQQATLHVDKGADELDQAEQHQKKARKKKIMLIVILAAVLLVLLLV 329
            :.:.:.|.|.|::|....|:|.:..:||||.||...:|:.|:::|:::|
Yeast   232 DKNVEDAQLDVEQGVGHTDKAVKSARKARKNKIRCWLIVFAIIVVVVVV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 49/205 (24%)
SNARE_syntaxin1-like 238..298 CDD:277201 22/60 (37%)
SSO1NP_015092.1 COG5074 1..268 CDD:227406 73/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343491
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.