DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and SYP41

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001031950.1 Gene:SYP41 / 832756 AraportID:AT5G26980 Length:322 Species:Arabidopsis thaliana


Alignment Length:357 Identity:68/357 - (19%)
Similarity:146/357 - (40%) Gaps:87/357 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RSLSTNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVSQNSHSCSNNNSSTEPKDRSSSK 76
            ||:....|:||..|:               .:||..   .|:...|.|..|.|.|..|.......
plant    18 RSVRAPLSSSSLTGT---------------RSGGVG---PVIEMASTSLLNPNRSYAPISTEDPG 64

  Fly    77 MTQYGSNVDDILNPYTEIRQQLAQIAANLE-TMNRMAQTVNLRTFNENEMDELHNKNLRLGNQLM 140
            .:..|:....:...:.::.:   :|:.|:: ...:||           |:.:.|.|      .||
plant    65 TSSKGAITVGLPPAWVDVSE---EISVNIQRARTKMA-----------ELGKAHAK------ALM 109

  Fly   141 TRFNDFKANLPAENDYSLEARMKRTLFYGLHQTFINLWHKNELFLQ-----------NYETKVKK 194
            ..|.|.|     |:.:::|:         |.|....|..|:|..||           |....|::
plant   110 PSFGDGK-----EDQHNIES---------LTQEITFLLKKSEKQLQRLSASGPSEDSNVRKNVQR 160

  Fly   195 NLRLHTKIINSEASEQ----------------EIELLIENKTTKLFVDNF---LQETE--KERQT 238
            :|....::::.|..::                ::|:.:.....:...|:|   |.|.:  |.:::
plant   161 SLATDLQLLSMELRKKQSTYLKRLRQQKEDGMDLEMNLSRNRYRPEEDDFGDMLNEHQMSKIKKS 225

  Fly   239 LREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQ 303
            ....::|..|::::.:|:.::..:...:..||::|..::.|::::.:.....|:.|..:|.:||:
plant   226 EEVSVEREKEIQQVVESVNDLAQIMKDLSALVIDQGTIVDRIDYNIENVATTVEDGLKQLQKAER 290

  Fly   304 HQKKARKKKI--MLIVILAAVLLVLLLVGIYL 333
            .|:.....|.  :|:::...:||:|:|..|:|
plant   291 TQRHGGMVKCASVLVILCFIMLLLLILKEIFL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 36/212 (17%)
SNARE_syntaxin1-like 238..298 CDD:277201 9/59 (15%)
SYP41NP_001031950.1 COG5325 73..318 CDD:227635 49/278 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.