DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and SYP131

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001319461.1 Gene:SYP131 / 821141 AraportID:AT3G03800 Length:306 Species:Arabidopsis thaliana


Alignment Length:329 Identity:68/329 - (20%)
Similarity:140/329 - (42%) Gaps:66/329 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVYSGTTEFIIGNTGGNNNSYSVVSQNSHSCSNNNSSTEPKDRSSSKMTQYGSNVDDILNPYTEI 94
            ::..|:.||               |::..:.|:..|...|.:.....::.:...|.:|...|.::
plant     3 DLLKGSLEF---------------SRDRSNRSDIESGHGPGNSGDLGLSGFFKKVQEIEKQYEKL 52

  Fly    95 RQQLAQIAANLETMNRMAQTVNLRTFN---ENEMDELHNKNLRLGNQLMTRFNDFKANLPAENDY 156
            .:.|.::....|....:.:...:::..   |.::||:..         ::||  .|..:...:..
plant    53 DKHLNKLQGAHEETKAVTKAPAMKSIKQRMERDVDEVGR---------ISRF--IKGKIEELDRE 106

  Fly   157 SLEARMK------------RTLFYGLHQTFINLWHKNELFLQNYETKVKKNL----------RLH 199
            :||.|.|            ||      .|.|.:..|.:..:..::| :::|:          |:.
plant   107 NLENRTKPGCGKGTGVDRTRT------ATTIAVKKKFKDKISEFQT-LRQNIQQEYREVVERRVF 164

  Fly   200 TKIINSEASEQEIELLIENKTTKLFVDNFLQETEKER--QTLREMMDRFNELRRLEKSIEEVHAL 262
            | :....|.|:.::.|||...::......::|..:.:  .||.|:.:|.:.:|.|||.:.::..:
plant   165 T-VTGQRADEETVDRLIETGDSEQIFQKAIREQGRGQIMDTLAEIQERHDAVRDLEKKLLDLQQV 228

  Fly   263 FMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKK-----IMLIVILAAV 322
            |:.:..||..|.|::..:|.....|..||..|.::|.:|.:.||.:||..     |:||:|:..|
plant   229 FLDMAVLVDAQGEMLDNIENMVSSAVDHVQSGNNQLTKAVKSQKSSRKWMCIAILILLIIIIITV 293

  Fly   323 LLVL 326
            :.||
plant   294 ISVL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 38/206 (18%)
SNARE_syntaxin1-like 238..298 CDD:277201 18/59 (31%)
SYP131NP_001319461.1 Syntaxin 35..240 CDD:366315 41/223 (18%)
SNARE 208..274 CDD:389950 19/65 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.