DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and SYP121

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_187788.1 Gene:SYP121 / 820355 AraportID:AT3G11820 Length:346 Species:Arabidopsis thaliana


Alignment Length:270 Identity:57/270 - (21%)
Similarity:122/270 - (45%) Gaps:29/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GSNVDDILNPYTEIRQQLAQIAANLETM---NRMAQTVNLRTFNENEMDELHN------------ 130
            |.|:|........::::|.::....||:   :..::|::    |...:.:|.:            
plant    41 GVNLDKFFEDVESVKEELKELDRLNETLSSCHEQSKTLH----NAKAVKDLRSKMDGDVGVALKK 101

  Fly   131 -KNLRLGNQLMTRFNDFKANLPAENDYSLEARMKRTLFYGLHQTFINLWHK----NELFLQNYET 190
             |.:::..:.:.|.|....:||.....|...|.:.::..||.:..::....    .||....|..
plant   102 AKMIKVKLEALDRANAANRSLPGCGPGSSSDRTRTSVLNGLRKKLMDSMDSFNRLRELISSEYRE 166

  Fly   191 KVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKER--QTLREMMDRFNELRRLE 253
            .|:   |.:..:......|:.::.||....::.|:...:||..:.|  .|:.|:.:|.:.::.:|
plant   167 TVQ---RRYFTVTGENPDERTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVKDIE 228

  Fly   254 KSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIMLIVI 318
            |::.|:|.:|:.:..||..|...:..:|.|..:|:..:..|.|:|..|..:||..||...:.|:|
plant   229 KNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTDQLQTARVYQKNTRKWTCIAIII 293

  Fly   319 LAAVLLVLLL 328
            |..::.|::|
plant   294 LIIIITVVVL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 37/201 (18%)
SNARE_syntaxin1-like 238..298 CDD:277201 16/59 (27%)
SYP121NP_187788.1 Syntaxin 44..249 CDD:395647 38/211 (18%)
SNARE 217..283 CDD:419871 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.