DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and SYP43

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_850519.1 Gene:SYP43 / 819740 AraportID:AT3G05710 Length:331 Species:Arabidopsis thaliana


Alignment Length:351 Identity:69/351 - (19%)
Similarity:141/351 - (40%) Gaps:86/351 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 STNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVSQNSHSCSNNNSSTEPKDRSSSKMTQ 79
            |::||..:.:.||               ||..:....|:...|.|..|.|.|..|........:.
plant    26 SSSSSTLTEHNSL---------------TGAKSGLGPVIEMASTSLLNPNRSYAPVSTEDPGNSS 75

  Fly    80 YGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFNENEMDELHNKNLRLGNQLMTRFN 144
            .|:....:...:.::.::::.......|  :||           |:.:.|.|      .||..|.
plant    76 RGTITVGLPPDWVDVSEEISVYIQRART--KMA-----------ELGKAHAK------ALMPSFG 121

  Fly   145 DFKANLPAENDYSLEARMKRTLFYGLHQTFINLWHKNELFLQ-------NYETKVKKNLR--LHT 200
            |.|     |:.:.:|...:...|         |..|:|..||       :.::.|:||::  |.|
plant   122 DGK-----EDQHQIETLTQEVTF---------LLKKSEKQLQRLSAAGPSEDSNVRKNVQRSLAT 172

  Fly   201 KIIN------------------SEASEQEIELLIENKTTKLFVDNF------LQETEKERQTLRE 241
            .:.|                  .:....::|:.:.....|...|:|      ..:..|.:::...
plant   173 DLQNLSMELRKKQSTYLKRLRLQKEDGADLEMNLNGSRYKAEDDDFDDMVFSEHQMSKIKKSEEI 237

  Fly   242 MMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQK 306
            .::|..|::::.:|:.|:..:...:..||::|..::.|::::.|.....||.|..:|.:||:.|:
plant   238 SIEREKEIQQVVESVSELAQIMKDLSALVIDQGTIVDRIDYNIQNVASTVDDGLKQLQKAERTQR 302

  Fly   307 KARKKKIM---LIVILAAVLLVLLLV 329
            :.  ..:|   ::|||..::||||::
plant   303 QG--GMVMCASVLVILCFIMLVLLIL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 36/212 (17%)
SNARE_syntaxin1-like 238..298 CDD:277201 12/59 (20%)
SYP43NP_850519.1 COG5325 81..327 CDD:227635 54/281 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.