DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and Stx3

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_008758484.1 Gene:Stx3 / 81802 RGDID:621005 Length:329 Species:Rattus norvegicus


Alignment Length:363 Identity:71/363 - (19%)
Similarity:140/363 - (38%) Gaps:95/363 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLPELLQRSLSTNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVSQ---NSHSCSNNN 64
            ||||.:|..:.|:.:.....             .|..|.||...:..:|.:.:   |....|.:.
  Rat     2 KDRLEQLKAKQLTQDDDTDE-------------VEIAIDNTAFMDEFFSEIEETRLNIDKISEHV 53

  Fly    65 SST-------------EPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVN 116
            ...             |||.:            ||:....|||:::...:...|::|.:      
  Rat    54 EEAKKLYSIILSAPIPEPKTK------------DDLEQLTTEIKKRANNVRNKLKSMEK------ 100

  Fly   117 LRTFNENEMDELHNKNLRLGNQLMTRFNDFKANLPAENDYSLEARMKRTLFYGLHQTFINLWHKN 181
                 ..|.||:.:                          |.:.|::::....|.:.|:.:..|.
  Rat   101 -----HIEEDEVRS--------------------------SADLRIRKSQHSVLSRKFVEVMTKY 134

  Fly   182 ELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRF 246
            .....::..:.|..::...:|...:.:::|:|.::|:....:|....: :::..:|.|.|:..|.
  Rat   135 NEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGII-DSQISKQALSEIEGRH 198

  Fly   247 NELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARK- 310
            .::.|||.||:|:|.:||.|..||..|..:|.|:|.:..|:...|::...:..:|.::|.:||: 
  Rat   199 KDIVRLESSIKELHDMFMDIAMLVENQGAMIDRIENNMDQSVGFVERAVADTKKAVKYQSEARRV 263

  Fly   311 -KKIMLIVILAAVLL--------------VLLLVGIYL 333
             ..:......::.||              ||.||..||
  Rat   264 SASVSACCTFSSCLLLRLYPDHEPMSFVSVLALVSSYL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 34/179 (19%)
SNARE_syntaxin1-like 238..298 CDD:277201 21/59 (36%)
Stx3XP_008758484.1 Syntaxin 32..226 CDD:279182 43/243 (18%)
SynN 32..181 CDD:238105 27/197 (14%)
SNARE 190..258 CDD:304603 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.