DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and Stx11

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001157062.1 Gene:Stx11 / 74732 MGIID:1921982 Length:287 Species:Mus musculus


Alignment Length:277 Identity:60/277 - (21%)
Similarity:117/277 - (42%) Gaps:48/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFNENEM-----DE 127
            |.::.|.|...|:....:|...|..:|..:...|   ||::.|:.|.:.    :||::     ..
Mouse     7 ELQELSRSYDQQFPDGDNDFDAPREDIVFETDHI---LESLYRVIQDIQ----DENQLLLIDVRR 64

  Fly   128 LHNKNLR-----------------LGNQLMTRFNDFKANLPAENDYSLEARMKRTLFYGLHQTFI 175
            |..:|:|                 :...:.||.......|.:..:.|.:|..:    :|.|....
Mouse    65 LGRQNVRFLTSMRRLSSIKRDTNSIAKAIKTRGEGIHQKLRSMKELSEQAEAR----HGAHSAVA 125

  Fly   176 NLWH----------KNELFLQNY-ETKVKKNLRL----HTKIINSEASEQEIELLIENKTTKLFV 225
            .:.|          :..::..|. |.|.:.|.::    ..:|:..:.|.::||.:.|.....:|.
Mouse   126 RISHAQYSALARAFQQAMYEYNQAEMKQRDNCKIRIQRQLEIMGKDMSGEQIEDMFEQGKWDVFS 190

  Fly   226 DNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLH 290
            :|.|.:.:..|..|.|:..|..||.|||..|.:||.||:::..||.:|.:.:..:|.:.|:...:
Mouse   191 ENLLADLKGARAALNEIESRHRELLRLEGRIRDVHELFLQMAVLVEKQEDTLNVIELNVQKTLDY 255

  Fly   291 VDKGADELDQAEQHQKK 307
            ..:...::.:|.|::||
Mouse   256 TGEAKAQVRKAVQYKKK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 47/216 (22%)
SNARE_syntaxin1-like 238..298 CDD:277201 18/59 (31%)
Stx11NP_001157062.1 Syntaxin 41..238 CDD:366315 45/204 (22%)
SNARE 207..273 CDD:389950 20/66 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836260
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.