DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and STX4

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_004595.2 Gene:STX4 / 6810 HGNCID:11439 Length:297 Species:Homo sapiens


Alignment Length:292 Identity:77/292 - (26%)
Similarity:154/292 - (52%) Gaps:20/292 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SHSCSNNNSSTEPKDRSSSKM------TQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTV 115
            :|.....:.|::.:|:....:      .:.||..::..:....|||.:.::...::.:.:...|:
Human     5 THELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTI 69

  Fly   116 NLRTFNE----NEMDELHNKNLRLGNQLMTRFNDFKANLPA-----ENDYSLEARMKRTLFYGLH 171
            ......|    .|:..|.::..:||.::..:   .||..|.     ||..|:..||::|....|.
Human    70 LATPLPEESMKQELQNLRDEIKQLGREIRLQ---LKAIEPQKEEADENYNSVNTRMRKTQHGVLS 131

  Fly   172 QTFINLWHKNELFLQNYETKVKKNLRLHTKIINS-EASEQEIELLIENKTTKLFVDNFLQETEKE 235
            |.|:.|.:|.......|..|..:.:|...||.|: ..|::|:|.::::..:::||.|.|::|:..
Human   132 QQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVT 196

  Fly   236 RQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQ 300
            ||.|.|:..|.:|:::||:||.|:|.:|..:.|.|..|.|:|.|:|.:...:..:|::|.:.:..
Human   197 RQALNEISARHSEIQQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKT 261

  Fly   301 AEQHQKKARKKKIML-IVILAAVLLVLLLVGI 331
            |.::||||||||::: |.:...|:|:.:::|:
Human   262 ALENQKKARKKKVLIAICVSITVVLLAVIIGV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 52/189 (28%)
SNARE_syntaxin1-like 238..298 CDD:277201 20/59 (34%)
STX4NP_004595.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 3/15 (20%)
SynN 39..189 CDD:238105 34/152 (22%)
Interaction with CENPF. /evidence=ECO:0000250 154..297 47/140 (34%)
SNARE_syntaxin4 199..261 CDD:277236 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.