DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and STX3

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_004168.1 Gene:STX3 / 6809 HGNCID:11438 Length:289 Species:Homo sapiens


Alignment Length:346 Identity:74/346 - (21%)
Similarity:147/346 - (42%) Gaps:80/346 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLPELLQRSLSTNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVSQ---NSHSCSNNN 64
            ||||.:|..:.|:.:....:             .|..|.||...:..:|.:.:   |....|.:.
Human     2 KDRLEQLKAKQLTQDDDTDA-------------VEIAIDNTAFMDEFFSEIEETRLNIDKISEHV 53

  Fly    65 SST-------------EPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVN 116
            ...             |||.:            ||:....|||:::...:...|::|.:      
Human    54 EEAKKLYSIILSAPIPEPKTK------------DDLEQLTTEIKKRANNVRNKLKSMEK------ 100

  Fly   117 LRTFNENEMDELHNKNLRLGNQLMTRFNDFKANLPAENDYSLEARMKRTLFYGLHQTFINLWHKN 181
                 ..|.||:.:                          |.:.|::::....|.:.|:.:..|.
Human   101 -----HIEEDEVRS--------------------------SADLRIRKSQHSVLSRKFVEVMTKY 134

  Fly   182 ELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRF 246
            .....::..:.|..::...:|...:.:::|:|.::|:....:|....: :::..:|.|.|:..|.
Human   135 NEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGII-DSQISKQALSEIEGRH 198

  Fly   247 NELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKK 311
            .::.|||.||:|:|.:||.|..||..|.|::..:|.:......||:|..||..:|.::|.:||||
Human   199 KDIVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKKAVKYQSQARKK 263

  Fly   312 KIMLIVILAAVLLVL-LLVGI 331
            .|::||::..:|.:| |::|:
Human   264 LIIIIVLVVVLLGILALIIGL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 34/179 (19%)
SNARE_syntaxin1-like 238..298 CDD:277201 22/59 (37%)
STX3NP_004168.1 Syntaxin 32..226 CDD:307101 43/243 (18%)
SNARE 194..260 CDD:328933 23/65 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.