DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and STX1A

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_016868056.1 Gene:STX1A / 6804 HGNCID:11433 Length:329 Species:Homo sapiens


Alignment Length:225 Identity:49/225 - (21%)
Similarity:101/225 - (44%) Gaps:21/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KDRSSSKMTQYGSN--------------VDDILNPYTEIRQQLAQIAANLETMNRMAQTV----N 116
            |||:....|...|:              :|:......|||..:.:||.|:|.:.|....:    |
Human     2 KDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPN 66

  Fly   117 LRTFNENEMDELHNKNLRLGNQLMTRFNDFKANLPAE---NDYSLEARMKRTLFYGLHQTFINLW 178
            .....:.|::||.:...:..|::.::....:.::..|   |..|.:.|:::|....|.:.|:.:.
Human    67 PDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVM 131

  Fly   179 HKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMM 243
            .:......:|..:.|..::...:|.....:.:|:|.::|:....:|....:.::...:|.|.|:.
Human   132 SEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIE 196

  Fly   244 DRFNELRRLEKSIEEVHALFMRIQTLVMEQ 273
            .|.:|:.:||.||.|:|.:||.:..||..|
Human   197 TRHSEIIKLENSIRELHDMFMDMAMLVESQ 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 42/186 (23%)
SNARE_syntaxin1-like 238..298 CDD:277201 15/36 (42%)
STX1AXP_016868056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S873
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.