DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and zgc:165520

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001295756.1 Gene:zgc:165520 / 571872 ZFINID:ZDB-GENE-070620-13 Length:285 Species:Danio rerio


Alignment Length:279 Identity:68/279 - (24%)
Similarity:135/279 - (48%) Gaps:27/279 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KDRSSSKMTQYGSNVDDILNP-------------YTEIRQQLAQIAANLETMNRM------AQTV 115
            |||.....::.....||:..|             ..|||..:.:|..|:..:.|:      |.|.
Zfish     2 KDRLEQLKSKSDQTADDVEIPMENKEFMDEFFAQIEEIRTSIDKIDENVVEIKRLYSVILSAPTS 66

  Fly   116 NLRTFNENEMDELHNKNLRLGNQLMTRFNDFKANLPA--ENDYSLEARMKRTLFYGLHQTFINLW 178
            ..:|  ::|::.:.|:..:|.|....:....:.||.|  |...|.:.|:|::....|.:.|:.:.
Zfish    67 EQKT--QDELEAVTNEIKKLANNARNKLKSIEQNLAANTEERVSADMRIKKSQHAILAKKFVEVM 129

  Fly   179 HK-NELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREM 242
            .| ||..:: :..|.|..::...:|.....:::|:|.:::.....:|... :.::...:|.|.|:
Zfish   130 TKYNEAQVE-FREKSKGRIQRQLEITGKATTDEELEEMLDGGNAAVFTAG-IMDSGISKQALSEI 192

  Fly   243 MDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKK 307
            ..|..::.|||.||:|:|.:|:.|..||..|..:|.|:|.:..|:...|::...:..:|.:.|::
Zfish   193 EARHKDIMRLESSIKELHDMFVDIAVLVENQGSMIDRIESNMDQSVGFVERAVADTKKAAKFQQE 257

  Fly   308 ARKKKIMLIVILAAVLLVL 326
            ||:|| |:|::...:|.|:
Zfish   258 ARRKK-MMIMLCCTILAVI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 46/188 (24%)
SNARE_syntaxin1-like 238..298 CDD:277201 20/59 (34%)
zgc:165520NP_001295756.1 Syntaxin 29..224 CDD:279182 46/198 (23%)
SynN 29..179 CDD:238105 31/153 (20%)
SNARE 188..255 CDD:304603 21/66 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.