DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and stx19

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_021334545.1 Gene:stx19 / 570366 ZFINID:ZDB-GENE-150909-2 Length:296 Species:Danio rerio


Alignment Length:225 Identity:47/225 - (20%)
Similarity:103/225 - (45%) Gaps:9/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NVDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFNENEMDELHNKNLRLGNQLMTRFNDFK 147
            :::::.:..::..:|.....|.:..::.|.:..|:....:...:.||.:...|..|.    ...:
Zfish    64 SIEELNSEVSKFNEQQKNFVATMRRLSIMKKESNMTRDIKLLAESLHKRLDALSKQA----KQTE 124

  Fly   148 ANL-PAENDYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSEASEQE 211
            |.| |......::......||...||.   :...|:..|...| |.|:.:....::...|.||:|
Zfish   125 AELGPNATTSRIQKIQHAALFLQFHQV---MRQHNDAILSKQE-KCKQFIIRQLEVSGREVSEEE 185

  Fly   212 IELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEV 276
            ::.:||....::|.:|.:.:.:..|..|.|:..|..||..||.:::::..||:.:..||.||...
Zfish   186 VDNMIEQGKWEIFNENIIVDAKITRTQLSEIEQRHKELLNLESNMKDLRDLFLDVFMLVEEQGHQ 250

  Fly   277 IQRVEFHAQQATLHVDKGADELDQAEQHQK 306
            ||.::.:.::...:|....::..:|.:::|
Zfish   251 IQNIQANVEKTQDYVSVTKEKFKRAARYKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 40/180 (22%)
SNARE_syntaxin1-like 238..298 CDD:277201 16/59 (27%)
stx19XP_021334545.1 Syntaxin 51..248 CDD:307101 41/191 (21%)
SNARE 216..282 CDD:328933 16/65 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.