DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and Stx1b

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_006508107.1 Gene:Stx1b / 56216 MGIID:1930705 Length:406 Species:Mus musculus


Alignment Length:250 Identity:59/250 - (23%)
Similarity:129/250 - (51%) Gaps:10/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VDDILNPYTEIRQQLAQIAANLETMNRMAQTV----NLRTFNENEMDELHNKNLRLGNQLMTRFN 144
            :|:......|||..:.:::.::|.:.:....:    |.....:.|:::|.....:..|::.::..
Mouse   147 MDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLK 211

  Fly   145 DFKANLPAE---NDYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSE 206
            ..:.::..|   |..|.:.|:::|....|.:.|:.:..:.......|..:.|..::...:|....
Mouse   212 AIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRT 276

  Fly   207 ASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVM 271
            .:.:|:|.::|:....:|.|:...:::..:|.|.|:..|.||:.:||.||.|:|.:|:.:..||.
Mouse   277 TTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVE 341

  Fly   272 EQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIMLI---VILAAVL 323
            .|.|:|.|:|::.:.:..:|::...:..:|.::|.|||:||||:|   |:|..||
Mouse   342 SQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 38/186 (20%)
SNARE_syntaxin1-like 238..298 CDD:277201 20/59 (34%)
Stx1bXP_006508107.1 Syntaxin 147..344 CDD:366315 39/196 (20%)
SNARE 345..396 CDD:368588 17/50 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.