DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and stx19

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001016670.1 Gene:stx19 / 549424 XenbaseID:XB-GENE-5749239 Length:292 Species:Xenopus tropicalis


Alignment Length:322 Identity:65/322 - (20%)
Similarity:131/322 - (40%) Gaps:63/322 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLPELLQRSLSTNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVSQNSHSCSNNNSST 67
            ||||.|.||::.....|..:.                                     |.:....
 Frog     2 KDRLEEFLQKAKELQMSKETE-------------------------------------SPSEGQK 29

  Fly    68 EPKD-RSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTV--NLRTFNENEMDELH 129
            ||.: :..:.:.:....:|..|:...:::..:|:::.::....:..:.:  |:|.|:..:.::..
 Frog    30 EPDELQQQAVIFEREPVLDSYLHEIQKLKNDIAELSDSVTKFGQEQKVLVSNMRRFSVMKREDNI 94

  Fly   130 NKNLRLGNQLMTRFNDFKANLPAENDYS--LEARMKRT-----LFYGLHQTFINLWHK-NELFLQ 186
            .|.:|:      :..:.|..|.:.:..:  :||....|     :..|.|..   |:.| ..:.||
 Frog    95 TKVIRV------QAENIKKRLDSLSQVAKKVEAEQGPTSGVVRIIKGQHSA---LFRKFQNIMLQ 150

  Fly   187 NYETKVKKNLRLHTKII------NSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDR 245
            ..:|...|..:..|.||      ..|.||:|:..::|.....:|.:|.|.|.:..|..|.|:..|
 Frog   151 YNDTIAAKQSKCKTFIIRQLEVAGKEVSEEEVNKMMEQGKWDVFNENLLTEVKITRSQLTEIEQR 215

  Fly   246 FNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKK 307
            ..||..||..::::..:|::|..||.||.|:|..:|...|....:|.:..::...|.::::|
 Frog   216 HKELVSLENQMKDLKDIFLQISLLVEEQGEMINNIEVSTQNTENYVQQTTEKFKLAVKYKRK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 43/195 (22%)
SNARE_syntaxin1-like 238..298 CDD:277201 18/59 (31%)
stx19NP_001016670.1 Syntaxin 47..244 CDD:366315 46/205 (22%)
SNARE 212..278 CDD:389950 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.