DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and stx3

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_031760934.1 Gene:stx3 / 549026 XenbaseID:XB-GENE-5825360 Length:326 Species:Xenopus tropicalis


Alignment Length:291 Identity:66/291 - (22%)
Similarity:135/291 - (46%) Gaps:43/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFNENE-MDELHNKNLRL---GNQLMTRFN 144
            :||..:...||||.:.:||..:....|:...:......|.: .|||.|..:.:   .|.:.:|..
 Frog    30 MDDFFSQIEEIRQNIEKIAECVNETKRLHSVILSAPLPEQKTKDELENLTMEIKKTANSVRSRLK 94

  Fly   145 DFKANLPAEN-DYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSEAS 208
            ..:.::..:: ..|.:.|::::....|.:.|:::..|......::..:.|..::...:|.....:
 Frog    95 TMEQSIEQDDMQSSTDLRIRKSQHSVLSRKFVDVMTKYNEAQVDFRERSKGRIQRQLEITGKSTT 159

  Fly   209 EQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQ 273
            ::|:|.::|:....:|....:.:::..||.|.|:..|..::.|||.|::|:|.:||.|..||..|
 Frog   160 DEELEEMLESGNPNIFTSGIINDSQISRQALSEIESRHRDIVRLESSLKELHDMFMDIAMLVENQ 224

  Fly   274 SEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARK---------------------------- 310
            .|.:..:|.:..::..||:|..:|..:|.::|.||||                            
 Frog   225 GESLDNIELNVMKSVEHVEKAREETTKAVKYQNKARKGTLIDRIENNMDESVGFVERAVADTKKA 289

  Fly   311 --------KKIMLIVILAAVLL--VLLLVGI 331
                    :||::|.::.||||  |.|::|:
 Frog   290 VKYQSEARRKIIIIGVVVAVLLGIVALIIGL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 41/184 (22%)
SNARE_syntaxin1-like 238..298 CDD:277201 20/59 (34%)
stx3XP_031760934.1 Syntaxin 30..225 CDD:395647 43/194 (22%)
SNARE 193..259 CDD:419871 21/65 (32%)
SNARE 263..>299 CDD:399038 0/35 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.