DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and stx11

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001008147.1 Gene:stx11 / 493509 XenbaseID:XB-GENE-952014 Length:285 Species:Xenopus tropicalis


Alignment Length:316 Identity:69/316 - (21%)
Similarity:129/316 - (40%) Gaps:58/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLPELLQRSLSTNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVS--QNSHSCSNNNS 65
            ||||.|||:.:            .|......|..|..:...|..:..:::.|  |:.......|.
 Frog     2 KDRLNELLEYA------------KLHTQYVQGEEEDELQGFGVFDTDHALESLYQDIQLIRTENH 54

  Fly    66 STEPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFNENEMDELHN 130
            ..:...:...|.|             |.....:.::::.....|.:|:.:..|.      :.:|.
 Frog    55 LMKVDVKRLGKQT-------------TRFLTSMRRLSSIKRDSNSIAKDIKTRA------EGIHK 100

  Fly   131 KNLRLGNQLMTRFNDFKANLPAEN---DYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKV 192
            |...|.|          .:..|||   :.|:.||:.::.:..|...|      .|..|:..|.::
 Frog   101 KLQSLKN----------LSEDAENKSGESSVMARVSKSQYMTLTLEF------QEAMLEYNEAEM 149

  Fly   193 ------KKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRR 251
                  |..::...:|:..:.|..:|:.:||.....:|.:|.|.:.:..|..|.|:..|..||.:
 Frog   150 VQRENCKIRIQRQLEIMGKDVSGNQIDDMIEQGKWDVFSENLLSDVKVARSALNEIETRHKELLK 214

  Fly   252 LEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKK 307
            ||..|.|||.||:::..||.||:|.:..||.:.::...:|.:...::.||.::::|
 Frog   215 LESRIREVHDLFLQMAILVEEQAETLNVVELNMEKVKDYVGEAKTQVRQAVEYKRK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 43/188 (23%)
SNARE_syntaxin1-like 238..298 CDD:277201 21/59 (36%)
stx11NP_001008147.1 Syntaxin 39..236 CDD:395647 49/231 (21%)
SNARE 205..270 CDD:419871 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.