DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and Syx1A

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster


Alignment Length:278 Identity:67/278 - (24%)
Similarity:138/278 - (49%) Gaps:12/278 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SSTEPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNR------MAQTVNLRTFNEN 123
            |..|.:...:..:..:.|.:||......|||..:.::..|:|.:.:      .|...:.:|  :.
  Fly    14 SDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKT--KQ 76

  Fly   124 EMDELHNKNLRLGNQLMTRFNDFKANLPAE---NDYSLEARMKRTLFYGLHQTFINLWHKNELFL 185
            |:::|.....:..|::..:....:.|:..|   |..|.:.|:::|....|.:.|:.:..:.....
  Fly    77 ELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQ 141

  Fly   186 QNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELR 250
            .:|..:.|..::...:|.....::.|:|.::|...:.:|....:.||::.:|||.::..|..::.
  Fly   142 TDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLADIEARHQDIM 206

  Fly   251 RLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIML 315
            :||.||:|:|.:||.:..||..|.|:|.|:|:|.:.|..:|.....:..:|.::|.|||:||||:
  Fly   207 KLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMI 271

  Fly   316 IVILAAV-LLVLLLVGIY 332
            ::.|..: :|....|..|
  Fly   272 LICLTVLGILAASYVSSY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 41/188 (22%)
SNARE_syntaxin1-like 238..298 CDD:277201 21/59 (36%)
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 43/198 (22%)
SNARE 231..281 CDD:399038 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467315
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S873
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.