DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and STX19

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001001850.1 Gene:STX19 / 415117 HGNCID:19300 Length:294 Species:Homo sapiens


Alignment Length:321 Identity:58/321 - (18%)
Similarity:132/321 - (41%) Gaps:61/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLPELLQRSLSTNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVSQNSHSCSNNNSST 67
            ||||.||.||:....                                   :|::||.     |:|
Human     2 KDRLQELKQRTKEIE-----------------------------------LSRDSHV-----STT 26

  Fly    68 EPKDR----SSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTV--NLRTFNENEMD 126
            |.:::    ..:.:.:.....:..|:...::::.:..:|.|::...:..:::  ::|.|:..:.:
Human    27 ETEEQGVFLQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRRFSLLKRE 91

  Fly   127 ELHNKNLRLGNQLMTR-FNDF----KANLPAENDYSLEARMKRTLFYGLHQTFINLWHKNELFLQ 186
            ....|.:::..:.:.| .||.    |.:.......|:..|:.::....:.:.|..:     :|:.
Human    92 STITKEIKIQAEYINRSLNDLVKEVKKSEVENGPSSVVTRILKSQHAAMFRHFQQI-----MFIY 151

  Fly   187 N-----YETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRF 246
            |     .:.|.|..:....::...|.||:::..::.....::|.::.|.|....:..|.|:..|.
Human   152 NDTIAAKQEKCKTFILRQLEVAGKEMSEEDVNDMLHQGKWEVFNESLLTEINITKAQLSEIEQRH 216

  Fly   247 NELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKK 307
            .||..||..|:::..||::|..||.||.|.|..:|........:|:...::...|.:::|:
Human   217 KELVNLENQIKDLRDLFIQISLLVEEQGESINNIEMTVNSTKEYVNNTKEKFGLAVKYKKR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 35/191 (18%)
SNARE_syntaxin1-like 238..298 CDD:277201 19/59 (32%)
STX19NP_001001850.1 Syntaxin 48..244 CDD:366315 37/200 (19%)
SNARE 212..278 CDD:389950 19/66 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.